KEGG   Alteromonas macleodii AltDE1: amad1_13690Help
Entry
amad1_13690       CDS       T02340                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    amad1_13690
   00565 Ether lipid metabolism
    amad1_13690
   00590 Arachidonic acid metabolism
    amad1_13690
   00591 Linoleic acid metabolism
    amad1_13690
   00592 alpha-Linolenic acid metabolism
    amad1_13690
Enzymes [BR:amaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     amad1_13690
    3.1.1.32  phospholipase A1
     amad1_13690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3076039..3077058
Genome map
AA seq 339 aa AA seqDB search
MSVLKPFVFLAAFAASTSVCGQETSSDVVSTQPQIVDSSEQQISNQNETNDPSQDEEGIE
VIDIIKRDTTSESALDDRLEGDKEALDNVFAITQHRQNYLLPITYVSNPNTTGNEDLTDE
NVDNKEAKFQVSAKLPLYLEDTGFDGVYFGFTLTSFWQLYNSEASKPFRETNYEPEIFWQ
ETADYSVLGYKFNTFQVGFNHMSNGQSGLQSRSWNRLFASIVFSDNDDIYYLKTWYRIPE
DEKEDPLDPTGDDNPDIEDYYGRMEFGYGRKIGAFKVLALLRNNLDFDENRGSIQLDLTY
PISDRYEILLQYFNGYGDSLIDYNRSQERIGLGFQLLFL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtgttaaagcctttcgtatttttggcagcgtttgctgctagcacaagtgtgtgt
ggacaagaaacatcctcagatgttgttagcactcaacctcaaatcgttgatagcagcgag
caacaaataagcaatcaaaacgaaaccaacgatccctctcaagatgaagaaggtatcgaa
gtcattgacattataaagcgtgataccacctcagaaagcgcgttagatgaccgtttagaa
ggtgataaagaagcgctggataacgtgtttgctattacgcaacatcgacaaaattacctg
cttcccattacttacgtttccaaccccaataccactggaaacgaagacttgacggacgaa
aacgtcgataataaagaagcaaaattccaagtcagtgccaaactccccctttacttagaa
gatacaggattcgacggggtgtattttggctttacgctgacatcattttggcagctgtat
aatagcgaggcatctaagccgtttcgcgagaccaactacgagccagaaattttttggcag
gaaaccgctgattattccgtactggggtataaatttaatacatttcaagtaggcttcaat
cacatgtctaatggtcaaagcggcctacaatcaagaagctggaaccgcttatttgcctct
attgtattcagtgataacgacgacatttattacctaaaaacctggtatcgtattcctgaa
gacgaaaaagaagatccattagatcctacgggcgatgataaccctgatatagaggactat
tacgggcgaatggagttcggatatggtagaaaaattggagcattcaaagtactcgcccta
cttagaaacaatttagatttcgatgaaaaccgaggcagtattcaactagatttgacttac
cccatttctgataggtacgaaatcttactgcaatatttcaacggctatggtgattcactt
atcgactataaccggtcgcaagagcgcattggtttgggtttccagctgcttttcttatag

DBGET integrated database retrieval system