KEGG   Alteromonas macleodii AltDE1: amad1_13955Help
Entry
amad1_13955       CDS       T02340                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_13955
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    amad1_13955
Enzymes [BR:amaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     amad1_13955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134765..3136360
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQKGTWEGINPEFAARMKVQNRFKTGLDIARYTAGIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTSKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQSEGDLAAQYNAFLKTTDIAGADDLTE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAEADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccaccttaaaggcagcacagaaagga
acgtgggaaggtataaacccagagttcgctgctcgcatgaaagttcaaaatcgtttcaaa
actggcttagacattgcccgttatactgcaggcatcatgcgtaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggctttgtaggccag
caaaaaatgctttcagttaaaaagcaccaaggtacaaccagcaaaagctacctttaccta
tctggttggatggtagcggcgcttcgctctgagtttggtccgctacctgaccaatcaatg
cacgaaaaaacgtcagtttctgcccttatcgaagagctttacaccttccttcgccaggca
gatgcccgtgaattaggcgaccttttccacaaactagacgacgcgaagaaaaacggcggc
gatgtagcggctatccaagctgaaatcgacaactacgaaactcacgtagtaccaattatt
gcggatatcgacgcaggttttggtaacgaagaagcaacttatctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaatcgaaaaccaagtgtcagatgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcaaaaatcaacgct
gtacgctatgcattccttgaactcggtgttgacgacggcgttattgttgcacgtactgac
tcactaggtgcgggtcttacccagaagatcccagtatctcagtcagaaggcgatctagca
gctcagtacaacgccttccttaagactaccgacattgctggcgcagacgacctaactgaa
ggtgacctagttcttaaacaaggtggcaagctagttaagccagagcgtttgccaaacggt
ttgttccgctttaaagacaacacaggttttgaccgcgtagtacttgactgtgttacgtcg
cttaagcacggtgctgacctactttggattgagactgaaaagcctcacgttggtcaaatt
gctgaaatggttaacgctattcgcgagcaagtaccaaacgctaagctggtatacaacaac
tctccatcgttcaactggacacttaacttccgtcagcaagtatttgatgcttggacagaa
gaaggtaaagatgtgtcgggttacgaccgtgcgaagcttatgtcagcagattacgatgat
agcgaacttgcagcagaagctgatgagaagattaagagcttccaagctgacgcggcacgt
gaagccggtatcttccaccaccttatcacgctacctacttaccacactgcagcactgtct
actgacaaccttgcgaaaggctatttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagaaattcgccaaggccttgcgtgtgttaaacaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaatcagtttgacgtataa

DBGET integrated database retrieval system