KEGG   Alteromonas macleodii AltDE1: amad1_13955Help
Entry
amad1_13955       CDS       T02340                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amaa01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amaa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3134765..3136360
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQKGTWEGINPEFAARMKVQNRFKTGLDIARYTAGIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTSKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSQSEGDLAAQYNAFLKTTDIAGADDLTE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAEADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccaccttaaaggcagcacagaaagga
acgtgggaaggtataaacccagagttcgctgctcgcatgaaagttcaaaatcgtttcaaa
actggcttagacattgcccgttatactgcaggcatcatgcgtaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggctttgtaggccag
caaaaaatgctttcagttaaaaagcaccaaggtacaaccagcaaaagctacctttaccta
tctggttggatggtagcggcgcttcgctctgagtttggtccgctacctgaccaatcaatg
cacgaaaaaacgtcagtttctgcccttatcgaagagctttacaccttccttcgccaggca
gatgcccgtgaattaggcgaccttttccacaaactagacgacgcgaagaaaaacggcggc
gatgtagcggctatccaagctgaaatcgacaactacgaaactcacgtagtaccaattatt
gcggatatcgacgcaggttttggtaacgaagaagcaacttatctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaatcgaaaaccaagtgtcagatgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcaaaaatcaacgct
gtacgctatgcattccttgaactcggtgttgacgacggcgttattgttgcacgtactgac
tcactaggtgcgggtcttacccagaagatcccagtatctcagtcagaaggcgatctagca
gctcagtacaacgccttccttaagactaccgacattgctggcgcagacgacctaactgaa
ggtgacctagttcttaaacaaggtggcaagctagttaagccagagcgtttgccaaacggt
ttgttccgctttaaagacaacacaggttttgaccgcgtagtacttgactgtgttacgtcg
cttaagcacggtgctgacctactttggattgagactgaaaagcctcacgttggtcaaatt
gctgaaatggttaacgctattcgcgagcaagtaccaaacgctaagctggtatacaacaac
tctccatcgttcaactggacacttaacttccgtcagcaagtatttgatgcttggacagaa
gaaggtaaagatgtgtcgggttacgaccgtgcgaagcttatgtcagcagattacgatgat
agcgaacttgcagcagaagctgatgagaagattaagagcttccaagctgacgcggcacgt
gaagccggtatcttccaccaccttatcacgctacctacttaccacactgcagcactgtct
actgacaaccttgcgaaaggctatttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagaaattcgccaaggccttgcgtgtgttaaacaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaatcagtttgacgtataa

DBGET integrated database retrieval system