KEGG   Alteromonas macleodii AltDE1: amad1_13965Help
Entry
amad1_13965       CDS       T02340                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_13965
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    amad1_13965
   00630 Glyoxylate and dicarboxylate metabolism
    amad1_13965
Enzymes [BR:amaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     amad1_13965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3137686..3139881
Genome map
AA seq 731 aa AA seqDB search
MQGYITKGRLQVAEQLDNFINEQALPGTGVDQEAFWQGAEALFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVGGSEYTDFLKNIGYLVEQPANVTADTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISDEGGAEAGKSYNPVRGAKVVAKAKTYLDNMIPL
AKGSHADVTQYKIDTGKLAITLTDGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QIDPTHPIGESDPANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGTLSI
EMTKGGKQLVRAMHDDRRYQPSKHAAKNQLKDGELVLSGRSLMFVRNVGHLMTNDAMLFD
GEEVPEGIMDGLITSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
PIIDVPTNTLKMGIMDEERRTSVNLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAAPF
AEKAALKAMPWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDANFDGLSDILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMTPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLASN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatatcacaaagggccgactacaggttgccgaacaactcgataactttatc
aacgaacaggcacttcctggcactggcgtcgaccaagaggcgttttggcaaggcgctgaa
gctctcttcgaaaaattcatacctcaaaatcgcgcgctactagaaaagcgagagcaactt
cagcgcgctattgatgactaccacaaagctgggaacccggtaggtggtagcgaatacaca
gacttccttaaaaacattgggtatctcgttgagcagcctgcgaacgttaccgccgacaca
caaaacgtagatgcagaaattgctactatggcggggccgcagcttgtagtacctattaat
aatgctcgctatgcacttaacgctgtaaacgctcgctggggaagcctgtatgatgcattg
tacggcactgacgttataagcgatgaaggcggcgcagaagcagggaaaagttataaccct
gttcgtggcgctaaagtagtagcgaaagcgaaaacctacctagataacatgataccgcta
gcgaaaggcagccacgcagacgttacacagtataaaattgatacgggtaaactggctatc
acgcttaccgatggcgatgaaaccaccctagcgaatactgaacaatggcaaggataccaa
ggcgatataagtgccccatcaagcctgctttttgcgcacaatggcctgcactttgaaatt
caaattgaccctactcacccgattggcgagagtgatccagcgaacgtaaaagacgtgctg
gttgaagccgctctgactaccattatggactgcgaagattccgttgccgctgttgatgct
gaagacaaaaccttggtgtacagcaactggttaggtttgatgaaaggcacgctcagcatt
gaaatgacaaaaggcggtaagcaacttgttcgcgccatgcatgacgatagaaggtatcag
ccctctaaacacgctgcaaagaatcagttaaaagacggagaacttgttctttctggccga
agcctaatgttcgttcgaaacgtcggtcaccttatgaccaacgacgccatgctttttgac
ggtgaagaagtaccagaagggatcatggatggtttaatcacttcccttatcgcaaagcat
gaccttttaggtaatagtaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcatgggcctgaagaagtggcgttctctaatgcgctatttggtgctatcgag
cctatcatcgacgttcccaccaacacccttaaaatgggcattatggatgaagaacgtcgt
acgagtgttaatctacaagcgtgtatcgctgaagcaacctcgcgggttgtgttcatcaac
acaggctttttggacagaacgggtgatgaaatacatacctcaatgcttgccgcgccgttt
gcagaaaaagccgcccttaaagctatgccatggattaaagcttacgagaccgcaaacgtt
gccgtaggtcttcgctgtggcctttctggtaaagcccaaattggtaaaggtatgtggccg
atacctgatgaaatgcaaaatatgatggatgctaaaattggtcatccgaaggctggggca
aatactgcatgggtgccctctcctactgcagcgacactgcacgcgcttcattatcacgac
gtgaatgtgtttgacgttcaaaagtcgctagatgcgaattttgatgggttaagcgatata
ctcactattcctttgttagaagatgcctcaacgcttacacgtgaaagtataaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggtgta
ggctgctctaaagttccagacatcaacaatgttggccttatggaagatcgcgcgacctta
cgtatttcatcgcagcatatcgcaaactggttagagcacggcattgtaagtgtagatcag
gtaaaagaatctttagcacgcatggcggtactggtagatgagcaaaacgcaggtgaccct
gaatatattcctatgacgcctgatttagatagctcaatcggcttcttagctgcaagcgac
ctcatcttcaaaggtaaagagcagcctagcggttacaccgaacctttattgcacgcccgt
cgacgcgagatgaaggcgaagctggcaagtaattag

DBGET integrated database retrieval system