KEGG   Alteromonas macleodii AltDE1: amad1_14320Help
Entry
amad1_14320       CDS       T02340                                 

Definition
(RefSeq) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    amad1_14320
  Carbohydrate metabolism
   00640 Propanoate metabolism
    amad1_14320
   00650 Butanoate metabolism
    amad1_14320
  Lipid metabolism
   00071 Fatty acid degradation
    amad1_14320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    amad1_14320
   00310 Lysine degradation
    amad1_14320
   00360 Phenylalanine metabolism
    amad1_14320
   00380 Tryptophan metabolism
    amad1_14320
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    amad1_14320
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    amad1_14320
   00281 Geraniol degradation
    amad1_14320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    amad1_14320
   00627 Aminobenzoate degradation
    amad1_14320
   00930 Caprolactam degradation
    amad1_14320
Enzymes [BR:amaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     amad1_14320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3225152..3225808
Genome map
AA seq 218 aa AA seqDB search
MAFNLAINNDIAVITFDDGKVNAVGFTLIEQFNNALDEAEKNAKAVVLHGGEGKFCGGFD
LSVMKSGDKEKQHELVSKGADLIVRLYSFPIPVIVAAEGHSIAMGAIMLMASDLRIGKDA
DTKYGLNETAIGMVLPPFGMELAKARLANTSQTEALLFSRIYQGNEAVKAGFLDAAVPQE
KVLATAMGYAEQLKMLPSQAFAASKLQLRKETLEKMKG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaatttagcgattaataacgatattgcagtcattacgtttgatgacggaaaa
gttaatgcagttggctttacccttattgagcaattcaacaatgcccttgatgaagcagaa
aaaaacgcgaaagccgttgtactgcatggcggtgaaggcaagttctgcggcgggttcgac
ttatcagttatgaaatctggggacaaagaaaaacaacacgagcttgtatcgaaaggggct
gatttaattgtacgcctctatagctttccaataccggttattgttgctgcagaaggccac
agtatcgcaatgggcgctattatgcttatggcgtcagacttgcgcataggtaaagatgcg
gataccaaatacggcctcaacgagacggctatcggtatggtactaccgccttttggtatg
gaactcgccaaagcaaggcttgctaacacgagccaaaccgaagcgctacttttctctcgt
atttatcaaggtaacgaagcggtgaaagcgggctttttagatgcagctgtgccacaagag
aaagtgttagcaacggctatgggatacgcggaacaacttaaaatgctgccttcccaagca
ttcgcagcatctaaacttcagctgcgaaaagaaaccttagaaaaaatgaaaggctaa

DBGET integrated database retrieval system