KEGG   Alteromonas macleodii AltDE1: amad1_14985Help
Entry
amad1_14985       CDS       T02340                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amad1_14985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    amad1_14985
   00020 Citrate cycle (TCA cycle)
    amad1_14985
   00620 Pyruvate metabolism
    amad1_14985
Enzymes [BR:amaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     amad1_14985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3376870..3378924)
Genome map
AA seq 684 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLS
VSVGDKIKEGDVIGEMKAAGGGSSDESSAEESSSDDASQEDAPKQEEAPKEESKSDSAPA
ASGTSEVIEVAVPDIGSDDEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTV
KEVLISNGDKVKEGTVVIKLEIAGEGGSSESSSSASSSTEKAEKSEASSNEASSQQESAP
KAEASSETIEVAVPDIGEDGEVDVIDVLVSAGDTVEKEDGLITLETDKATMDVPSTHAGT
IKEVFIKTGDKVKQGTLVVKLETSGGETSAPASEKPAEAPKQEAPKKEASKQSSQQAESQ
NRSPVPPAPEAKSTGKAHASPSVRRVAREFGVDLTQVKGSGPKNRILKEDVQAYVKAELA
KPKTAAASGNAPAGDNVLQIVPVKTVDHSKFGEIEEQKLSRIQKISGPFLHRNWATIPHV
TQFDEADITDVEDFRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGE
SLIIKKFINIGIAVETPGGLVVPVIRDVNKKGIEELSRELIETSKKAREGKLKAADMQGG
TFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVI
DGAVGARFSTEVAANLTDLRRIIL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtacccgatgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaacattgaagccgatgaaggcgttgttactgttgaa
agtgacaaggcgtcaatggacatcccagcaccgtttgaaggtgagattgtaagcctgtct
gtatcagtaggcgataaaatcaaagaaggcgatgtgattggtgaaatgaaggctgcaggt
ggtggcagttcggatgagagcagcgctgaagaatcatcttcagacgacgcttcacaagaa
gacgcgcctaagcaagaagaagctccaaaagaagaaagcaagtcagattcagcgcctgct
gcttctggtaccagtgaagtgattgaagttgccgtaccggatatcggctctgatgacgaa
gtagacgttatcgacgtgttggtttcagtgggcgacaccatcgaaaaagaagatggtctt
attacccttgaaactgataaagcgacgatggacgttccctcaacacacgcgggtacagtg
aaagaagttcttatcagtaatggtgataaggtaaaagaaggcacggtagtgattaagctt
gaaatagctggtgaaggcggttcaagcgaatcgtcttcaagtgcatcgtcttcaactgag
aaagctgaaaaatcagaagcgtcttctaacgaagcgtcgagccaacaagaatcagcacct
aaagcagaagcaagcagcgagactatcgaagttgctgtacctgatattggtgaagacggt
gaagttgacgttatcgatgtacttgtatcggctggcgatacggttgaaaaagaagacggc
ctaattacgctagaaactgataaagccaccatggatgtaccttcaacacatgcaggtacc
atcaaggaagtctttattaaaacaggcgataaggttaagcaaggcacattggttgttaag
ctagaaactagcggtggtgaaacttcagcgccagcgtctgaaaagccagctgaagcacct
aaacaagaagcgcctaagaaagaagcatcaaaacagtcttcgcaacaagccgagtctcaa
aatcgctctcctgtgcctccagcgccagaagcgaaaagtacaggtaaagcacacgcttca
ccatcagtacgccgtgttgcgcgcgagtttggtgtagacctaactcaggttaaaggctca
ggccctaaaaaccgtattttgaaagaagacgttcaagcctatgtgaaagcggaactggct
aagcctaaaactgcggccgcgtcaggtaatgcccctgcgggtgacaacgtacttcaaatt
gtgccggttaaaactgttgatcacagcaagtttggtgaaattgaagagcaaaagctttcg
cgcattcagaagatttctggcccgttcttacaccgtaactgggcgacgattccgcacgtt
acgcagtttgatgaagccgatatcacagacgtagaagatttccgtaaagagcaaaacgct
taccacgcgaagattaagtctggtcttaagattacgccgctagtattcgtaatgaaagcg
gtagcgaaagcccttgagaaatacgaagtatttaactcatcactgtctgacgacggcgaa
agcttaattatcaaaaagttcattaacattggtattgcggtggaaacaccgggcggcctt
gtagttcctgttattcgcgacgtgaataagaaaggcattgaagaactttctcgcgagctt
atcgaaacatcgaagaaagcccgtgaaggtaagcttaaagctgcagacatgcagggtggt
acgtttactatctctagcctaggtggtattggcggtacggcgtttacgcctattgtaaat
gcaccagaagtcgccatattaggtgtgtctaagtctgagatgaagcctaagtggaatggt
aaagagtttgaaccgcgtctgatggtgcctttgagcctgtcatacgatcaccgtgtaatc
gatggtgcagtaggtgcaagattctctaccgaggttgctgcaaacctaactgacttacgc
agaatcatactttaa

DBGET integrated database retrieval system