KEGG   Alteromonas macleodii AltDE1: amad1_15125Help
Entry
amad1_15125       CDS       T02340                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    amad1_15125
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    amad1_15125
Enzymes [BR:amaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     amad1_15125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3409861..3411411)
Genome map
AA seq 516 aa AA seqDB search
MVVSAFIQSTKALLAKFGVDAPDIRIEGLTLDSREVNTRLAFLAIKGHERDGRDFIPQAI
SLGARVILAQTDDSEAHGQMEMRDHSVIISLYELPQMLSALAAAFYDYPAQKMTTVAVTG
TNGKTSTVQLLTQLKDTLGTRSASIGTLGSSVFEGDATQWSNTPAANTTPDAIRMQYLLA
DFVQSEVRHAAFEASSHALVQGRLGTVKTDIAVFANLTRDHLDYHGTMEEYGKAKRLLLC
QPGLKAVVLNANDDESNKWDNVADNAITRIWTGIDESADGALFRAHNNPQSRHCFATNAS
YHSGGCSFELVSSWGSAAISLPLFGKFNISNVLSAIGTLLAEGERFDAVVKAVNAITPVP
GRMEVFPVPGAANLVVDYAHTPDALEKVLLSAKFHTAGKVWCVFGCGGDRDTGKRPLMGQ
AAEAGADAIVITTDNSRSEDPESIAQDIITGLKDSSLAVSIPDREQAIRHCLAHADKSDI
IIVAGKGHEDYQIIGDKKTNYNERAVVARLQQEYSK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttagtgcctttattcaaagtaccaaagcattgctggcgaagtttggtgtagac
gcaccggatatacgtattgaaggccttactttagatagccgcgaagtgaacacgcggtta
gcttttttagccattaaagggcatgagcgcgacggtcgtgattttatccctcaggcaata
agtttaggggcccgtgtaattctggcgcaaactgacgacagtgaagctcatggtcaaatg
gagatgcgcgatcacagcgttatcatttctctttatgaactaccccaaatgctctctgca
ttagctgcagccttttatgactatcccgcacaaaagatgacaacggtagcggttactgga
actaatgggaaaacatctacagttcaattgcttacgcaacttaaagacacgttaggtacg
cgtagtgcaagcataggtaccctaggtagcagtgtgtttgaaggcgatgcgacgcaatgg
tcgaacacgcctgcggccaacaccacgccagatgccatacgtatgcagtacttattggca
gactttgtgcaaagcgaagtgcgccatgccgcctttgaggccagttctcacgcgttggtt
caggggcgacttggtacggttaaaaccgatatagctgttttcgccaacctcacgcgggat
catctcgattatcacggcacgatggaggaatacggtaaggctaagcgcctactgctttgt
cagcctgggttaaaagcggtggtgttaaacgctaacgatgatgaaagtaataaatgggac
aatgttgctgacaatgctattacccgcatttggacgggtattgatgaaagtgctgatggt
gcgttatttcgcgcccacaacaatcctcaaagtcgccattgtttcgccacaaatgcttct
tatcattccggtggatgtagctttgaactggtgagctcgtggggaagtgccgccatttcc
ctaccgcttttcggtaaattcaatattagtaatgtgctaagcgcaataggaacacttctg
gcagaaggtgagcgttttgatgcggtggtaaaagcggttaatgcgatcacccctgtgcca
gggcgaatggaagtgtttccagtacccggtgctgccaacttggtggtggactacgcccac
acccctgacgcactggaaaaggtgctgctaagcgccaagtttcataccgctggaaaagtg
tggtgtgtatttggttgtggcggtgatagagacacaggaaagcgcccattaatggggcag
gctgctgaagctggcgctgatgccattgttatcaccactgataacagccgtagcgaagac
cctgaatctatcgcgcaggacattattaccggtttaaaagacagtagccttgcggtgtca
attcctgacagagagcaagctattcgtcattgcctagcgcatgctgataaaagcgacatc
atcattgtggccggaaaaggccatgaagattaccaaattatcggtgacaaaaagactaac
tataacgaacgtgcggttgtggcgcgactgcaacaggagtacagcaaatga

DBGET integrated database retrieval system