KEGG   Alteromonas mediterranea DE1: amad1_15330Help
Entry
amad1_15330       CDS       T02340                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    amad1_15330
Enzymes [BR:amaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     amad1_15330
Transporters [BR:amaa02000]
 Other Transporters
  Pores ion channels [TC:1]
   amad1_15330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: AFV86560
Position
complement(3452870..3453502)
Genome map
AA seq 210 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKLIDLKQGQHLSDEYKAVSPSAKIPVLATPEG
TLSESAAIVTYLAERHGMQEFIPEPSSFSRAKYEEMMLFLTSELEQPVWNLAKHTFALPE
SQRLEEMHGVSAWEFQRALRVFASMLGGNEFVCGNMFTMADVIAGHILAWAKGSKLAIDF
QNISDYAQRVLTREAYERAWRGEMSHLPAQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttacggttaccctaaaacccgctcggttcgtgtagcgtgggcgctggaa
gaaattggtttaccttacgaatacaaactaatcgacttgaaacaaggtcagcatttgtct
gatgaatataaagcagtaagcccatcggcgaaaataccggtattggcaacccccgagggc
acactgtctgagtcagctgccattgtcacttacttggctgagcgccacggtatgcaagaa
tttattcccgagcctagcagtttctcgcgggctaagtacgaagagatgatgctatttctc
accagtgagctagaacagccggtttggaatttagccaagcacacgtttgctttacccgaa
tcgcaaagactggaggaaatgcacggcgttagtgcgtgggaatttcagcgtgcgctcagg
gtgtttgcttctatgcttggcggtaacgaatttgtttgcggtaacatgtttactatggcc
gacgttattgcagggcatattttagcgtgggctaagggcagtaagttagcaatcgacttt
caaaatataagtgactacgcacaacgtgtactgacacgagaagcctatgagcgtgcgtgg
cgcggcgaaatgtcgcacttacccgctcaataa

DBGET integrated database retrieval system