KEGG   Alteromonas macleodii AltDE1: amad1_15410Help
Entry
amad1_15410       CDS       T02340                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    amad1_15410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    amad1_15410
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    amad1_15410
Enzymes [BR:amaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     amad1_15410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3466086..3467369)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTASFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIDVLRAL
IGDELNNGELEEIVKTAFAFGAPVEQVNDNVYSLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISALQEKLFTTLGGNIHTVAI
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKRDQLV
ISVPSGNFGNLTAGMIAKSLGLPIKRFIAATNLNDTVPRYLKTGEWDPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLQDGEIGLFLGTAHPAKFRETVENVLGNPISLPKPLADVAGEDSLAVDLPASYDALKQ
HMINLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcgagctttgctgaagcggtaaag
cgtggtttaggtaagaaccaagggctttattttccagagcatattcctaccttagacaat
attgacgaattgctggaaaagccatttgtagagcgcagcattgatgtgcttcgtgcgctt
attggagacgagcttaataacggcgagcttgaagaaattgtcaaaacagctttcgcattt
ggtgcgccggttgagcaggttaacgataacgtttatagcctagagcttttccacggccca
acccttgcgtttaaagactttggtggccgttttatggcacaaacgctctcgcgtataagc
gaaggtaagcctgtgaccatcctaactgccacgtcaggcgatacaggtgcagctgttgct
catgcgttccacggtatcgacaatatcaacgtggttatcttgttccctaagggcaagatc
agcgcgttgcaagaaaagcttttcactacgttgggcggtaatattcacactgtagcaatc
gaatcagattttgatgcatgccagtcccttgtgaaaactgcgtttgacgacccagatgtg
cgtgaaggtcttcacctcaactctgcgaactctattaatataagtcgtttactggcacag
gtatgttactactttgaagcggttagccaactgcccaaagagaagcgcgaccagcttgtt
atttcggtacctagcggtaacttcggtaatcttacggcaggcatgatcgctaaatcgtta
ggcctaccgattaaacgcttcattgccgcaactaacttaaacgataccgtgcctcgttac
ttaaaaacgggtgagtgggacccgaaagcgacggttgccactatgtcgaacgcaatggat
gttagccagccgaacaactggccgcgtattgaagcgttaattgagcgtggttacatcgac
aaagcgtgcctcaagggtgaaatggttgatgaagaatatactcagcttgccatgcgccag
ctagcgcagcaaggctacaccagtgagccacacgctgctattgcctatcgcgcggtaagc
cacgacctgcaagacggtgaaattggcctgtttttaggtactgctcacccagctaagttc
agagaaacggtagaaaacgtattgggtaacccaataagcttgccaaagccgttagcagac
gtagcgggcgaagacagcctagcggtagacttacctgcgtcctatgatgcgcttaagcag
cacatgattaacttgcttaagtaa

DBGET integrated database retrieval system