KEGG   Alteromonas macleodii AltDE1: amad1_15820Help
Entry
amad1_15820       CDS       T02340                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:amaa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3559373..3559945)
Genome map
AA seq 190 aa AA seqDB search
MKLYGSTTSPYVRRIRIVLASTEHAFLNLQIFSGEDRELLTSRNPTLKVPCLEDDGQMIF
DSRIIYNYLSDKLDHEGLSWEEENQLTLIDAANDSFVQLMLLKRSDFDISQDKMYFRLQN
ERIEAVLSALSEQLDAGGFSGWTYPEICLYTMIDWVLFRELHDMKDYPQLLEFHEQHHNR
IEVTATDPRS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtatggctctaccacctctccttatgttcgccgtattcgtattgtgttggcg
tctacggagcatgcgtttttgaaccttcaaatattctcaggtgaagatcgcgagctactc
acctctcgtaacccaacgctcaaagttccgtgcctcgaagatgacggccaaatgattttt
gactcccgtattatttataactacctctctgacaagctggatcacgaaggcttgagttgg
gaagaagagaaccagttgaccttaatcgatgcggctaacgattcatttgtacagctgatg
ttactcaagcgttctgatttcgacattagccaagataagatgtacttcagacttcaaaac
gagcgcattgaagcagtgcttagcgcattatccgaacaactggatgcaggtggcttcagc
ggctggacatacccagagatttgcttgtacaccatgattgattgggtgctctttagagaa
ctacacgacatgaaggattaccctcaactgctggagtttcatgaacagcatcacaaccgt
attgaagttaccgccacagaccctcgaagctag

DBGET integrated database retrieval system