KEGG   Alteromonas macleodii AltDE1: amad1_16945Help
Entry
amad1_16945       CDS       T02340                                 

Definition
delta-9 fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amaa01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amaa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3828490..3829617
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNALVFIISGAIAFIGVPLWVAYQGIDWAEIGTAIFLFYFTGMSITAGYHRL
WSHKTYDANIVVRVILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDSVVMWQHKYYLPIVLAANFGITGLLGYLNGDVMGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGVLAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSYVGLTSNLRKVPEERIEKALAAMQLQRASEKVSVLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTHLQSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatcctaactaatgcgctggtatttataatatctggcgcaata
gcatttattggtgtgccgctatgggtggcgtatcaaggcattgattgggcagaaattggt
actgctatatttctgttctactttaccggcatgtcaattactgctggttatcaccgtctg
tggtctcacaagacctacgatgcaaacattgttgtgcgtgtcattcttgctatcggcggc
gctatggccttgcagaatagtattttgcattggtcttctgatcaccgtgtgcatcaccgc
catgtagacgacaacgacaaagatccttactctgcaaagaaagggctttggttcgcgcac
atcggctggatgttacgcgagtatcaagctaagcgttacgatgactacagcaactgtaaa
gacctgcaaaaagatagcgtggtgatgtggcagcacaaatactacttacctatcgtactc
gctgctaactttggcattactggtctattaggctatttgaacggcgacgtaatgggcatg
attttagtagcgggcgttcttcggttggtgctagttcatcatgttacgttttttattaat
tctctggcccatttttggggtagtcagccttataccgataaaaatacggcgcgagataat
ggcgttttagctttcttcacgtttggcgagggttatcacaactaccaccatatctttgaa
tacgattaccgcaacggcattcgttggtatcagtttgatcctactaaatggctaatcaaa
gggctgtcttatgtaggtttaacgtcgaaccttcgcaaagtacctgaagagcgcatcgaa
aaggcactggcggccatgcagcttcaaagggctagtgagaaagtatcggtactgcccaac
gctgaagaaatgatgcacactattcaagaagagtacgacctgcttatgcagcgaatgagt
gaatactacgcgacgaaaaagcgcgtgatgcgtgttaagcaacgcaccttaaaacgcagt
attgaagggttagaacttgcatataagtacaaagaactgaagcacgcgtttgctgtgcag
aaagaaaaatggacacatttgcaaagcttatcgttacaaatggcctag

DBGET integrated database retrieval system