KEGG   Alteromonas macleodii AltDE1: amad1_18405Help
Entry
amad1_18405       CDS       T02340                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    amad1_18405
Enzymes [BR:amaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     amad1_18405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4169546..4170043
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDSEGKAQKAFDAMGKLEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETALKPHGLLKQLQRIELEEGRERKGERWGPRTLDLDILLYGSENIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGKPISAWVANCSLDGLRRLRSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagaacacgtatatattggcgtaggcagtaaccttggcgatagtgaaggtaaa
gcccaaaaagcattcgacgcaatgggcaaattagaagatacccgcgttttaaagacctcg
tcactttactctagtaaaccaatgggcccacaggatcagccagactacatcaatgcagta
tgcttgatagaaactgcgttgaagcctcatgggctgctaaagcagcttcagcgcatagag
cttgaagagggccgtgagcgcaaaggcgaacgctggggccctcggaccctcgatttggat
attttgctatacggcagtgaaaatattgatactgccgacctaatcattccgcactatgga
atggctgagcgagaattcgtcatggtgccgctgtttgaaattgcgcccaatatggtgatg
cacgacggcaagccgatttctgcttgggtagcaaactgctccctagatggacttcgacgc
ctacgctcttccaattag

DBGET integrated database retrieval system