KEGG   Alteromonas macleodii AltDE1: amad1_18650Help
Entry
amad1_18650       CDS       T02340                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
amaa  Alteromonas macleodii AltDE1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amaa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4228674..4229357)
Genome map
AA seq 227 aa AA seqDB search
MLAKEAVIVRDALDPSISEPAQRVREALEAKGLETPMVANGLSDEQKRKRIESAMRDVMD
TLGLDLTDDSLCDTPTRIAKMYVNEIFGGLDYRRFPKITAIENKMQIDQPVQVSDISLTS
TCEHHFVTIDGTATVSYIPKNTVIGLSKINRLVGFFAQRPQVQERLTQQVLVALQTLTNT
DDVAVSINATHYCVKARGIRDTNSYTKTSALGGRFLTESELKREFFR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaaaagaagcggtaattgtgcgcgatgcactagacccctctatatcagagcca
gcgcaacgtgtacgagaagcattagaagccaaaggtttagaaaccccaatggttgccaac
ggcctttcagacgagcaaaaacgtaagcgcatagaaagtgctatgcgtgatgtaatggac
acgcttggccttgatttaacggacgacagcttatgtgatacaccaacgcgcatagcgaaa
atgtacgttaatgagatctttggcgggttggattatcgcagatttcctaagatcacggca
attgaaaacaaaatgcagatcgaccagcctgtacaggtctctgacattagccttacaagc
acgtgcgagcatcactttgtaactatcgatggtacggccacggtatcttatattccgaaa
aacacggttattggcctttcgaaaataaatcggttagtgggtttctttgctcagcgtcct
caggtgcaagaacgcttaacacagcaagtgttagtagcattgcagacattgacgaatacc
gacgatgtggccgtaagtattaatgcgacccactattgcgtgaaagcgagagggatccgt
gataccaattcatataccaaaacgtctgcattaggtggccgcttcttaacggaaagtgaa
cttaaacgagagtttttccgttaa

DBGET integrated database retrieval system