KEGG   Alteromonas mediterranea DE1: amad1_18715Help
Entry
amad1_18715       CDS       T02340                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
amaa  Alteromonas mediterranea DE1
Brite
Enzymes [BR:amaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     amad1_18715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4244473..4245132)
Genome map
AA seq 219 aa AA seqDB search
MIDLYTAATPNGWKASVALEEMGLKYTAHGVNLMKGEQKTPEFLAMNPNGRIPVIVDREE
DGHVVFESGAIMIYLAEKTGMFLPRDAKRKSQVIQWLMFQMGGIGPMMGQANVFHRYFED
KIPVAIARYQNEVRRLFTVLDGHLENKAYLVDDYSIADMANWCWVRTYEWSGVSIEGLDN
LIRWKNSIEARPAARRGVEVPNKIDKEALIKGAKNVVTK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttatacacagcagcgacaccgaatggatggaaagcctcggtggctttagaa
gaaatgggcctcaaatacacggcacatggcgtcaacttaatgaaaggggagcagaaaacc
cctgagtttttagccatgaaccccaacggtcgcattcctgtcattgttgatagagaagag
gatgggcatgtagtcttcgaatcgggcgctatcatgatatatctggcagaaaagacgggc
atgtttttaccgcgtgacgccaagcgcaagagccaagttattcaatggctcatgtttcaa
atgggcggtattggccccatgatgggccaggcgaatgtctttcatcgctacttcgaagat
aagatacccgttgctatcgcccgatatcaaaacgaagtgcggcgtttatttacggtgctt
gatggccatcttgaaaacaaagcatacttagtcgatgactacagcatcgctgatatggct
aactggtgctgggtgcgcacgtacgagtggtctggtgttagcatcgaagggctagacaat
cttattcgctggaagaacagtattgaagcgaggcctgcagcacgcagaggtgtggaagtg
ccgaacaaaatcgataaagaagcgttgataaaaggggcgaaaaacgttgttacgaaatag

DBGET integrated database retrieval system