KEGG   Alteromonas macleodii AltDE1: amad1_19810Help
Entry
amad1_19810       CDS       T02340                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amaa  Alteromonas macleodii AltDE1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4492209..4493042)
Genome map
AA seq 277 aa AA seqDB search
MMQILTIKHVAMTVASLAFLMGCSPNQHDSVSLDSESEAAKPQSIAKFKAYTKRFDGEIN
MSENHATGHVGDVFFTHWKDGGKASLKLSQSGEFEVNWQGGGYNYVGGPGWHYGDVNREI
GYRFDEESGASYIALYGWGYDKSMPQDNPAHLVEYYVLQRWTYDPSQNGILGKTFVSNGV
EYSTYRTIREQKPSINNTATFYQYWSKPSNPMPLGKDHKIIFADHVAAWADTGWILPDMN
NLDASDDPTYQVMAVEVFNPAKDGKATGKVWDASAQL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagatattgacgattaaacatgttgcgatgacggtagcgagtctcgcctttctt
atgggctgctcacctaatcaacacgattcagtaagcctagatagtgaatcagaggctgct
aagccgcaatctattgctaaatttaaagcctatacaaagcgatttgatggtgaaataaac
atgtctgaaaatcatgccactggacacgttggtgatgtgtttttcacccattggaaagac
ggcggcaaagcctcgctcaaactaagccaaagcggagaatttgaagtgaattggcagggc
ggaggatacaactatgtgggtggccctggttggcattatggagatgtgaaccgtgaaatt
ggctatcgctttgacgaggagagtggcgctagttacatcgcactttatggttggggttac
gacaagagtatgccgcaagacaatcccgctcacttagttgaatattatgttcttcagcgc
tggacttatgatcctagccaaaacggcattttgggcaaaactttcgtgagtaatggcgtt
gaatactcaacatatcggactattcgagagcaaaagccctctataaataatacggcgact
ttttaccagtattggagtaaaccgtctaatcccatgcctttaggtaaagaccataaaatt
atttttgccgatcacgttgcagcttgggctgatacaggctggattcttcctgatatgaac
aatcttgacgcaagcgacgaccctacatatcaagttatggcggtagaagtgtttaaccct
gcaaaagacggtaaggcgaccggtaaagtgtgggatgctagtgctcaactttaa

DBGET integrated database retrieval system