KEGG   Alteromonas macleodii ATCC 27126: MASE_00270Help
Entry
MASE_00270        CDS       T02246                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:amac00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MASE_00270
Enzymes [BR:amac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MASE_00270
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MASE_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62835..63644
Genome map
AA seq 269 aa AA seqDB search
MPELPEVEVSRLGVSPHLIGNTITQVVVRERRMRWPIPQEVANVEGQSVIAVKRRAKYLL
IETAKGTLILHLGMSGKLRVIDASTPIIKHDHVDIVLNTGKCLRFNDPRRFGAVLFQAPD
MQIAMLDNLGPEPLTDDFDDKRLFKLSRNRKGPVKNFIMDNAIVVGVGNIYANEALFLAG
IDPRRAAGNISAARYQSLTATIKQVLAKAIEQGGTTLKDFAQTDGKPGYFAQHLNVYGRK
GEPCEVCGKAIESKVIGQRNTFFCTHCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactaccagaagttgaagtaagccgtttgggcgtttctccacaccttattggc
aataccattacgcaggtggtggtgcgtgagcgaagaatgcgctggcccattccacaagag
gtagcgaacgttgaagggcagagcgttattgctgtaaaacgccgcgctaaatatctactt
attgaaacagccaaaggcacgttaattttacatttaggtatgtcgggtaaattacgcgtt
atcgatgcatcgacaccaattattaagcatgaccacgtagacattgttttaaacaccggt
aagtgcttacgttttaacgacccaaggcgctttggtgcagtgttatttcaggcccctgat
atgcaaatagccatgcttgataacttgggcccagagccgcttacagacgactttgacgat
aagcgcttatttaaactatcgcgcaatcgaaaaggccccgttaaaaacttcattatggat
aacgccattgtggtaggtgtaggaaacatctacgcgaacgaagcactgtttttagctggt
atagacccgcgaagagccgcaggcaacatcagcgctgctcgctatcagtcgttaactgca
accattaagcaagtattggccaaagccattgaacaaggcggcacaacattaaaagacttt
gcgcagaccgacggtaagcctgggtattttgcacagcacttgaatgtgtatgggagaaaa
ggcgagccttgtgaagtgtgtggaaaagccatcgaaagtaaggttattgggcagcgaaat
acctttttctgtactcactgccaacgctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system