KEGG   Alteromonas macleodii ATCC 27126: MASE_00505Help
Entry
MASE_00505        CDS       T02246                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MASE_00505
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MASE_00505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114041..114682
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYESNTATPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFNEFDSVIINDDFATA
LNDLEAIVTAQRLRTGKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactactcggcaacttattcattcttgcagctccttctggagcaggaaaatca
agccttattaaggcgctaatggaaaagtatgaaagcaatacagctacgccaatgcaggtg
tctgtatctcatacaacacgtcaacctcgtccgggtgaagtcgacggcgtgcactaccat
tttgtgagccgagagcagtttgaagcgctgattgaacagggtgtgttttttgaatacgca
gaagtatttggcaattattacggcacatcccgcgtgacaattgaacaaactttgcaccgt
ggcattgacgtatttttagatatcgattggcagggcgcgcgccaagtcaaaaagcttatg
ccagacacatgcggtattttcattcttccgccttcactcgacgtgctagagcagcgttta
aataatcgcggtcaagacagtgaagaagtcattgcagggcgtatggcgcaagccgtagct
gaaatgtctcatttcaatgaattcgatagtgtaattatcaacgacgactttgcgactgcg
ttaaacgatttggaagccatcgttacagcacagcgacttcgcacgggaaaacaacaaatg
cgccatcaagtgctattggacgaactgctcggtagcgcgtaa

DBGET integrated database retrieval system