KEGG   Alteromonas macleodii ATCC 27126: MASE_00925Help
Entry
MASE_00925        CDS       T02246                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amac00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amac00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amac00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204845..206974)
Genome map
AA seq 709 aa AA seqDB search
MSSLTSFVRLSNEKATLIFDCQGRMPKVIYYGAPLSDSTTPEMLSVLNTRQEAKCAPVIE
PPITLVPTHGDGWTGQPGLEVSGDADQWSAGFSLTEINEDAQSVAFVSEDARRGMRLITT
VELDNKTSVVKYVSRLENSGETPLNLGYLNAASLPLPTSVSKIKTFEGRWSAEFQTKDHD
LFFGSYVRENRRGKTSHDTFPGLIAFPQGTGELNGECYGYHLGASANHKLRAELMADGRS
YVQFGELLFPGEVVLNAGESYTSPVLYTGYGCEGFSSLSQQFHNFIRSNVLNHSAESKPR
PVHYNTWEGIYFDHNEDELKALADKVAPLGIERFVLDDGWFKGRRNDKAGLGDWFVDEAI
YPEGLDGLIDHVTGLGMEFGIWFEPEMVNPDSDLYRAHPEWALQTEDNPHVPFRNQYVLD
LTNPEVVEYLYKVITDVLKAYPKISYIKWDMNRDVNHPGNLHGKPAMHGQMAALYSLIDR
VKAAKPGIEIESCCSGGGRVDLGILPHTDRFWTSDSNDALDRLYIQRGCSYFFPAEVMGA
HVGPRDCHITGRHLPIEIRSAVALFGHMGIEMDPRELTDHEQSVLTDAISLYKKYRHITH
GGDLFRMDDDGMNVKFGYVSKDKQEGIFAYNSVLETVRTTPNRFYFAGLDANKQYTIERV
WPEKLKEYTPSILQQTDGQVFSGEVLMKYGMQLPVLFPQTALIYTVKAV
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactcacatcattcgttcgtttgtcgaacgagaaagccacattaatattcgac
tgccagggtcgtatgcccaaagtcatttactatggtgcgccgttaagtgacagtacaaca
ccagaaatgctgagcgttttaaacacccgtcaagaagccaaatgcgcacccgtaattgaa
ccgccgattacgttggtaccgactcacggtgacggctggacgggtcagccaggtcttgaa
gtgtcgggcgatgccgaccagtggtcagcaggctttagcctgaccgaaataaatgaagat
gcacagtctgttgctttcgtaagcgaagacgctcgccgcggtatgcgtcttatcacaact
gttgagctcgataacaaaacgagcgtagtaaaatacgtttctcgtctcgaaaacagtggc
gaaacaccgctcaatttaggctatttgaatgccgctagcctgcccttgcctacgtccgta
agcaaaattaaaacatttgaaggccgctggtcagcagagtttcaaaccaaagatcacgac
ctcttctttggaagttatgtacgtgaaaatcgccgaggcaaaacatctcacgacaccttc
cctggcctgattgcatttcctcaaggcacgggtgaacttaacggtgagtgctatggttat
caccttggcgcttctgcaaaccacaagcttcgcgctgagctaatggctgatggcagaagc
tatgtgcagtttggtgagttattatttccaggtgaagtggtacttaacgctggcgaaagc
tatacatcccccgtgctttacacaggctatggctgtgaaggtttctcttcgctatcacaa
cagttccataacttcattcgcagcaacgtgctaaaccacagtgctgaatcgaagcctcgc
ccggtgcactacaacacctgggaaggtatttatttcgatcataacgaagatgaacttaaa
gccttagccgataaagttgcacccttgggcattgagcgctttgtgttagatgatggttgg
tttaaagggcgcagaaacgacaaggctgggcttggcgactggtttgttgatgaagctatc
taccctgaaggactagacgggctcattgaccatgttactggccttggcatggaattcggt
atttggtttgagccagagatggtaaaccccgacagtgacctgtaccgcgcacatcctgag
tgggcgctgcaaaccgaggataacccccacgtccctttcagaaatcagtacgtattggat
ttaaccaaccccgaagtggttgagtacctttacaaagtgattactgatgtattgaaggcg
taccccaaaatcagctacatcaaatgggacatgaaccgcgacgtaaaccaccccggcaac
cttcacggtaaacctgcgatgcatggtcaaatggctgcgctttacagcttaatagaccgc
gtcaaggcagctaagccaggcattgagatagaaagctgttgttcaggcggcggccgtgta
gatttaggtattttgccacacacagatcgtttctggacgtcggattctaacgacgcacta
gaccgtttgtatattcagcgtggttgttcttatttcttcccggctgaagtaatgggcgca
cacgttggcccgcgcgactgccatataacgggtagacacttacctattgagattcgttcg
gcagtagccttgtttggccatatgggtatagagatggacccacgtgaacttactgaccac
gagcaaagcgtgcttactgatgctatttcactttacaaaaagtatcgtcatatcacccac
ggcggcgatctattccgcatggacgatgacggcatgaacgtaaaatttggttatgtatct
aaagacaagcaagaaggtatttttgcatataacagcgttttggaaactgttcgcactacg
ccaaaccgcttctactttgcaggtcttgatgctaataaacaatacaccattgagcgtgta
tggcctgaaaagctaaaagaatacaccccgtctattttgcaacaaactgatggccaagta
ttctcaggtgaagtattgatgaaatacggcatgcagctgccggtattgttcccgcaaact
gcactaatttataccgttaaagcggtatag

DBGET integrated database retrieval system