KEGG   Alteromonas macleodii ATCC 27126: MASE_01200Help
Entry
MASE_01200        CDS       T02246                                 

Definition
(GenBank) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac02020  Two-component system
amac02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MASE_01200
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MASE_01200
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MASE_01200
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     MASE_01200
Two-component system [BR:amac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MASE_01200
Bacterial motility proteins [BR:amac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MASE_01200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AFS35811
Position
272041..273087
Genome map
AA seq 348 aa AA seqDB search
MPIKVLVVDDSALIRQILSEIVTRDPGLTLVGAAPDAYAAKRMVQEFRPDVITLDIEMPK
VDGLRFLEVMMKAMPTPVVMISTLTERGADATLRALELGAVDFMAKPKLGVAQGMAEYAA
VIVEKIKAAAHSRLGQPTQTRCTKHASMRYTGTEKLIGIGASTGGTEAIKDVIMHFPRNA
PATIISQHMPPGFTTTYAKRLDSLCEITVREAHGGERLLPGFAYLAPGNKHLKVERSGAD
YRLTLDDGPKVSGHKPSVDVMFDSLAEHAGANAVGVLLTGMGRDGAKGLKSMHTKGSVTF
CQDEKTCVVYGMPKVAVEMKAASFIKPLEDISDAILDTLEALGAGSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcctataaaagtcctcgtagttgatgactctgcgttaatccgccaaatcctttcagaa
atagtaacccgagatccaggtttaacgcttgtgggtgcggcgccggatgcttatgcggcg
aagcgaatggtgcaagagttcaggccagacgttattactctggacattgaaatgccgaag
gtagacgggttacgttttttagaagtaatgatgaaggcgatgccgaccccagttgtgatg
atatctacgctgactgaaagaggtgccgacgcaacactgcgtgcgctcgaactaggcgct
gtggattttatggcaaagccaaagctcggcgtagcgcaaggtatggctgaatacgcggcg
gttattgttgaaaagataaaagcagcagcgcattcgaggttaggccaacctacgcaaaca
cgctgcacaaaacatgcttctatgcgctacacaggaaccgaaaagttaattggtataggc
gcatcaactgggggaaccgaagcaataaaagacgttatcatgcattttccccgcaatgca
ccggccaccattatttcccaacacatgcctccagggttcacaaccacctacgccaagcgg
ctcgatagcctttgtgaaataaccgtgagagaagcgcacggaggggagcgtttattgcct
ggatttgcgtacttggcaccaggtaataaacatttaaaagtggagcgtagcggcgctgac
tatcgtttaacccttgatgatggccccaaggtatcgggacacaagccctccgttgatgtg
atgtttgactcgctggctgagcatgctggcgcaaacgcggtgggtgtgctgcttacaggc
atgggacgggatggagcaaaaggccttaagagtatgcacacaaaaggctctgttacgttt
tgtcaggatgaaaaaacctgcgttgtttacggtatgcctaaagtggctgtagaaatgaaa
gccgctagttttatcaagccgttagaagatatctcagatgcaattctagatacgctagaa
gcattgggcgcgggctcgcgcctttaa

DBGET integrated database retrieval system