KEGG   Alteromonas macleodii ATCC 27126: MASE_01245Help
Entry
MASE_01245        CDS       T02246                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amac02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amac02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
284216..285262
Genome map
AA seq 348 aa AA seqDB search
MTIKVLVVDDSALIRQILSEIIKSEPDMALVGAAPDAFVAKKLVLEKSPDVITLDIEMPK
VDGLRFLEVLMNARPTPVVMISTLTEKGADATLRSLELGAIDFVAKPKIGVAQGMADYHQ
LIVEKIRTAARSKVKKSAPSKVSTVSKVNYSGTEKIIAIGASTGGTEAIKEVLRTFPANA
PATVITQHMPAGFTSTYAKRLDAVCQMQVKEAKGGERLLPGQAYLAPGDKHMEIERSGAD
YRIRLTDGARVSGHKPSVDVLFNSICKSAGSNALGVLLTGMGSDGASGLHEMFNAGCETF
CQDEASCIVFGMPKVAIEKGAAKRVISLDDMGRSVMQTVEKLSAGSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaagttttggtggtagatgactcggcactgatccggcaaattctaagtgag
attataaaaagtgagccagacatggcattagtgggtgctgctcccgatgctttcgtggca
aaaaagctggttctagaaaagtcgccagatgttattacacttgatatagaaatgcctaaa
gtggacggattacgctttctagaagtactgatgaatgcgagaccgacgcctgtagtcatg
atttctacgttaaccgaaaaaggcgctgatgctacgctgaggtccttggagttaggagct
atcgactttgttgcaaagcccaaaataggtgtggcgcaaggcatggcagactatcaccag
ttgattgttgagaaaatacgtacggctgcgcgctctaaagtaaaaaaatcagcgccttcg
aaagtgtctaccgtgagcaaagtcaattattcgggtactgagaaaatcattgcaattggt
gcctcgaccggagggacagaagccataaaagaggtgttacgtacctttccggcgaacgct
cctgccaccgtgatcacacaacacatgccagcagggtttacttcgacttacgctaaacga
ctagatgccgtgtgccaaatgcaggtcaaagaagcgaaaggcggagaacgtttactacca
ggccaagcctaccttgcacctggcgataaacacatggaaattgaaagaagcggggctgat
taccggattagattgaccgatggcgcgcgcgtatcgggtcacaagccctcggtggatgtg
ttatttaattctatctgtaaaagtgctggtagcaatgcgttaggcgttttacttacgggc
atgggtagcgacggcgcaagcggccttcacgaaatgtttaacgcgggctgcgaaacattt
tgtcaggacgaagctagttgtatagtttttggtatgcccaaagtagccatagaaaagggc
gccgctaagcgcgtaataagcctagatgatatgggcagaagtgttatgcaaaccgtagaa
aagctctcggcaggtagtcgcttgtaa

DBGET integrated database retrieval system