KEGG   Alteromonas macleodii ATCC 27126: MASE_01860Help
Entry
MASE_01860        CDS       T02246                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:amac00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
433715..434692
Genome map
AA seq 325 aa AA seqDB search
MNWTFTSENNLASTFATYINPFWQNSVTQGHFSGKDNIKVRFAHCIPESPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTRDPQHGYVADFDDYVDDFVMFVET
IVKPLQQGPLQLVCHSMGGAIGALTLLRLPNLFSKAVLASPMFGIKPALPNWLANGLIRT
GLAVNRMKKKDAGYFFGQTPYIAFPFSLNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIESSARAITTPSLILSADDDAIIDNNRQRRVAQLMPNAKLEIVPRAYHEL
FTESDDIRERSVARILDFLTEDSST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacgttcacgtctgaaaataacttagccagcacttttgccacgtatatcaat
cccttctggcaaaacagtgttactcagggccacttctctgggaaagacaatatcaaggta
cgctttgcgcactgtatcccagaatcgccgcgagctaccattgtaatatgctctggtcga
atcgaatcttatttaaagtacaaagagttcatttacgatctctatcaaaatggtttcgcc
gtattcatcttagatcacagaggccaaggtttgtcagacaggatgacccgtgaccctcag
catggttatgttgccgattttgacgactacgttgatgacttcgttatgttcgtagaaact
attgtaaagccactgcagcaaggcccgttacagctggtatgccattcgatggggggcgcc
attggtgcactcacgctgctgcgtcttccgaatttgttttcaaaagccgttttagcttca
cccatgtttggcattaaacccgctctgcccaattggttggcgaatggcttaattcgcaca
ggccttgcggtaaacaggatgaaaaagaaagatgcggggtacttttttggtcaaaccccg
tatatcgcgtttcctttttcacttaataagctcacccacagcaaaacccgctatgccctg
tttcgtgagctgtatgacgaagaacaggatattcagcttggtggcgtgactacagagtgg
ttggcagcggcacatcaggctatgaacaaaattgaaagtagcgcacgcgctattacaacg
ccctcgcttatattaagtgcagacgatgacgcgattattgataataaccgtcagcgccgc
gtggctcagcttatgccaaatgcaaaactggaaatagtgccccgcgcttaccatgagcta
ttcaccgagtctgacgacattcgcgagcgctctgtggcgcgtattctcgactttttgaca
gaagactcgtctacataa

DBGET integrated database retrieval system