KEGG   Alteromonas macleodii ATCC 27126: MASE_01860Help
Entry
MASE_01860        CDS       T02246                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MASE_01860
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MASE_01860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
433715..434692
Genome map
AA seq 325 aa AA seqDB search
MNWTFTSENNLASTFATYINPFWQNSVTQGHFSGKDNIKVRFAHCIPESPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTRDPQHGYVADFDDYVDDFVMFVET
IVKPLQQGPLQLVCHSMGGAIGALTLLRLPNLFSKAVLASPMFGIKPALPNWLANGLIRT
GLAVNRMKKKDAGYFFGQTPYIAFPFSLNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIESSARAITTPSLILSADDDAIIDNNRQRRVAQLMPNAKLEIVPRAYHEL
FTESDDIRERSVARILDFLTEDSST
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacgttcacgtctgaaaataacttagccagcacttttgccacgtatatcaat
cccttctggcaaaacagtgttactcagggccacttctctgggaaagacaatatcaaggta
cgctttgcgcactgtatcccagaatcgccgcgagctaccattgtaatatgctctggtcga
atcgaatcttatttaaagtacaaagagttcatttacgatctctatcaaaatggtttcgcc
gtattcatcttagatcacagaggccaaggtttgtcagacaggatgacccgtgaccctcag
catggttatgttgccgattttgacgactacgttgatgacttcgttatgttcgtagaaact
attgtaaagccactgcagcaaggcccgttacagctggtatgccattcgatggggggcgcc
attggtgcactcacgctgctgcgtcttccgaatttgttttcaaaagccgttttagcttca
cccatgtttggcattaaacccgctctgcccaattggttggcgaatggcttaattcgcaca
ggccttgcggtaaacaggatgaaaaagaaagatgcggggtacttttttggtcaaaccccg
tatatcgcgtttcctttttcacttaataagctcacccacagcaaaacccgctatgccctg
tttcgtgagctgtatgacgaagaacaggatattcagcttggtggcgtgactacagagtgg
ttggcagcggcacatcaggctatgaacaaaattgaaagtagcgcacgcgctattacaacg
ccctcgcttatattaagtgcagacgatgacgcgattattgataataaccgtcagcgccgc
gtggctcagcttatgccaaatgcaaaactggaaatagtgccccgcgcttaccatgagcta
ttcaccgagtctgacgacattcgcgagcgctctgtggcgcgtattctcgactttttgaca
gaagactcgtctacataa

DBGET integrated database retrieval system