KEGG   Alteromonas macleodii ATCC 27126: MASE_02020Help
Entry
MASE_02020        CDS       T02246                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464538..465548
Genome map
AA seq 336 aa AA seqDB search
MTSSPFPQRRMRRLRAKDALRGLVAEHRLTTDDLIYPVFVLPGENAREAVPSMPGVERLS
IDLLGQETAKWVELGIRTIALFPVTPMSLKTECASEAFNPEGLAQQAMRALKKAFPEVML
MSDIALDPFTSHGQDGLLDETGYVMNDETVEVLIKQALSHAEAGADIVAPSDMMDGRIGN
IRKALEEAGHINTCIMAYSAKYASAYYGPFRDAVGSAANIKGGNKKTYQMDPANTDEALH
EIALDIEEGADMVMVKPGMPYLDVVRRCKDEFKVPTFAYQVSGEYAMHQAAFANGWLNED
AVILESLLAFKRAGADGILTYFAPQAAALLAKQNDK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcacctttccctcaaagaagaatgcgcagactacgcgccaaagatgcttta
agagggcttgtggcagagcaccgtttaaccactgacgatctcatttaccctgtttttgta
ctacccggtgagaacgcacgagaagccgtaccttctatgcctggtgtggaaagactttct
atcgatttgctagggcaagaaacggcgaaatgggtagagctgggcattagaacgattgcg
cttttccctgtgacacctatgtctcttaaaaccgagtgtgcaagcgaagcgttcaatcct
gaagggcttgctcagcaagctatgagagcgctcaaaaaggcgtttcctgaagtaatgctg
atgtctgatatcgcattagatccatttacgtctcatggtcaagatggcctcttagacgaa
actggttatgtgatgaacgacgaaacagtcgaggtgctcattaagcaagcgttatcgcat
gctgaagctggcgctgatattgttgcgccttctgacatgatggatgggcgcattggcaat
atccgaaaagcacttgaagaagcaggtcacatcaatacgtgtattatggcttattctgct
aaatacgcgtctgcgtactacggtccatttcgtgatgccgtcggctccgctgcaaatata
aagggcggcaacaagaaaacctatcaaatggatcctgccaacaccgatgaagctctccac
gaaattgcgcttgatatagaagagggcgctgacatggtaatggtgaagccaggtatgccg
tatttagatgttgtgcgtcgttgtaaagacgaatttaaagtaccgacattcgcctatcaa
gtaagtggcgagtacgctatgcatcaagctgcttttgctaatggttggctaaatgaagac
gcggtgatcctagaatcgttattagcgtttaagcgcgctggcgccgacgggattctgact
tatttcgctccgcaagctgctgcgcttttagcgaagcaaaacgacaagtaa

DBGET integrated database retrieval system