KEGG   Alteromonas macleodii ATCC 27126: MASE_02155Help
Entry
MASE_02155        CDS       T02246                                 

Definition
beta-hexosaminidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MASE_02155
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MASE_02155
Enzymes [BR:amac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MASE_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495843..497816
Genome map
AA seq 657 aa AA seqDB search
MLFQQVICKKRASLMGLSAILSGILILLSASLFTASATAQSESANASNNPKPSADAETIR
AVKNMLGQKIILDFRYFCEDNTPSSRCRTPMTVIPPSLLNVLSTHNIGGVILFSENIQNT
EQLITLNYTMQQHMVKAGRQPLFIAVDQEGGRVARLPSDMLSPFAGNMAIGATFHQRGSA
FAQSVASHIGQTLLPLGINTNFAPSVDVNSEPKNPVINVRSFSENPEQVAALGQTFVSAM
QSTGVMSAIKHFPGHGDTHVDSHSGLPQVTHSKAQAMAGDILPFANIINSATPPAMVMSA
HIQYPSLDDTTIIDKHGKSQIVPATLSKKILSNLLRNQLGYQGLIVTDALDMAGITQFFS
HEEALVSAFSAGADIALMPFTIRNQDDIKKFALLLDNAANRMSESAFLKASHNRIIKAKQ
RFALQSFISKPMSWWLNEAKENASMNNPNSLKNRGIQIEKALSKSSVSVLFGKDELPITS
NRWLALMPDAARCLAFEAALTRARSNFNNKTLQFACLPLTALPKTQLAMNLLKQADVLVV
GNISPLHANYELGGVDLPEHVKRRASETEVMAFSKKIMVAAKAQNKTVVFAPLRMPYKAH
DVKELADVAIATFSYAVNIIQQSDKENQHVTSYSLNALVDVILGSALAEGRSPVSLK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
ttgttattccagcaagttatttgtaaaaaacgtgcttcattgatgggccttagcgctatc
ttgtcaggcatactcattttattaagtgcttcactgtttactgctagcgcaaccgctcaa
tctgaaagtgctaacgcttcgaataatcctaagcccagcgctgatgccgaaacaattcgc
gctgtaaaaaacatgctcgggcaaaaaatcattttggattttcgctatttctgtgaagac
aatacgccgtcttcgcgctgccgtacgcccatgaccgtaattccaccgtcacttttaaat
gtgcttagtacgcacaacatcggcggtgttattttgttttcagagaacattcaaaatacc
gagcagttaattacgctcaattacaccatgcagcagcatatggtaaaagcaggtcgtcag
ccgttatttattgctgtcgatcaagaagggggcagagtagcaaggttgccttcagacatg
ctctcgccgtttgcgggtaacatggccattggcgccacttttcatcagcgaggcagcgca
tttgcgcaaagtgtggcatctcatattggccaaacgcttttaccgctgggaataaacacc
aattttgcgccgtcggttgatgtaaatagcgagccgaagaaccccgttattaacgtacgc
agcttttcggaaaatccagagcaggtagccgcactcgggcagacatttgtcagtgctatg
caaagtacaggtgtaatgagcgctatcaaacattttccaggccatggtgatacccatgta
gatagccacagtggcctgccgcaagtaacgcatagcaaagcgcaagctatggcgggtgac
atccttccttttgcgaatatcattaatagtgcaacgcctcctgcaatggtaatgagtgca
cacattcagtacccgtctttagacgatacgacaattattgataagcatggtaagtcacaa
atagttcctgctactttgtcgaagaagatactaagcaatttgcttcgcaaccaattagga
tatcaaggccttatcgttactgacgcgttagacatggcaggtattactcagtttttctcc
catgaagaagcattagtcagtgcattcagcgcaggtgctgatattgcgcttatgccgttc
accataagaaaccaagacgacataaaaaagttcgcgttacttttggataatgcagcaaat
cgaatgtcggaaagcgctttcttgaaagcgtctcataatcgtattattaaggcaaaacag
cgctttgctttgcaaagttttatttccaagcccatgtcatggtggctcaatgaagcgaaa
gaaaatgcttcaatgaataaccctaacagtttgaaaaacagaggaattcaaattgagaaa
gcgctttctaaatcgtcagtttctgtactcttcgggaaggatgagttgccaataacttca
aatcgctggttggcgcttatgccagacgcagcaagatgtttagcatttgaagccgcgctt
acacgcgcacgttccaacttcaacaataagactctgcagtttgcgtgtttgccgttaact
gcgttacctaaaacccaattagcaatgaatctactaaaacaagctgacgtgctggtggtt
ggtaatattagtccgctacatgctaactatgaattaggaggagtcgatttacctgagcat
gtgaaacgacgcgcaagcgagactgaggtgatggcatttagcaaaaaaataatggttgct
gcgaaagcacagaataaaaccgtggtctttgctccactgcgcatgccatataaagcgcat
gacgtgaaagagctagccgatgttgctattgctacatttagttatgcggtgaacattata
cagcaaagtgataaagaaaatcagcacgttacgagctatagtcttaatgctttggttgat
gtaatacttggtagcgcgctcgctgagggacggtcacctgtttcgttgaaatag

DBGET integrated database retrieval system