KEGG   Alteromonas macleodii ATCC 27126: MASE_02315Help
Entry
MASE_02315        CDS       T02246                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00071  Fatty acid degradation
amac00280  Valine, leucine and isoleucine degradation
amac00281  Geraniol degradation
amac00310  Lysine degradation
amac00362  Benzoate degradation
amac00380  Tryptophan metabolism
amac00410  beta-Alanine metabolism
amac00640  Propanoate metabolism
amac00650  Butanoate metabolism
amac00903  Limonene and pinene degradation
amac00930  Caprolactam degradation
amac01040  Biosynthesis of unsaturated fatty acids
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
amac01200  Carbon metabolism
amac01212  Fatty acid metabolism
Module
amac_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MASE_02315 (fadB)
   00650 Butanoate metabolism
    MASE_02315 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MASE_02315 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MASE_02315 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MASE_02315 (fadB)
   00310 Lysine degradation
    MASE_02315 (fadB)
   00380 Tryptophan metabolism
    MASE_02315 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MASE_02315 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MASE_02315 (fadB)
   00281 Geraniol degradation
    MASE_02315 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASE_02315 (fadB)
   00930 Caprolactam degradation
    MASE_02315 (fadB)
Enzymes [BR:amac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MASE_02315 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MASE_02315 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MASE_02315 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MASE_02315 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah 5_3_exonuc_N
Motif
Other DBs
NCBI-ProteinID: AFS36025
Position
complement(521839..523989)
Genome map
AA seq 716 aa AA seqDB search
MIYTGKSLSVSLLEDGFAELVFDAQGSVNKFDRQTVSELDEATQALLAKGDVKGLVVRSA
KPAFIVGADITEFTGLFAMDDAEVLQWVANTSQVFDRFEDLPFPTIAAVNGFALGGGCEM
ALACDMRIADTTASIGLPEVKLGLMPGFGGTVRLPRLIGSDNALEWMTTGRDRKGAKALA
EGAVDAVVAPEALVEGALSMVKDAADGKFDWQARRAVKKAPLQLNKNEAMMSFSTAQAMV
FAQAGKHYPAPHKMVETVQKAAGLDREGALKLENEGFVALAKTDAAKAQIGIFLADQLVK
SKGKKQAKAATKQSKLNAVLGAGIMGGGIAYQSAVKGTPVIMKDINQGALDLGLSEAAKI
LGKGMQRGKVDATKMAQTLNAITPTLEYSTLKDADLVIEAVVENPKVKGIVLKEVEDNVA
DDAIICSNTSTISINQLAESLDKPERFCGMHFFNPVHRMPLVEIIRGEKTSEETINAVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLLIDGADFVAVDKVMEKIFGWPMGPAY
LMDVVGIDTGDHAADVMAAGIPERMARLDNDPVTLFYKEQRLGQKNGKGFYNYGVDKRGK
PSKTPAEEAYALMAPHVAEKTDFEADDIIARLMIPMANEAIRCLEEGIVDSAAEADMALL
YGLGFPPFRGGIFRWIETIGLANFVAMADKYAELGPIYQISDGVREMAAAGKSYFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaggcaaaagtctttccgtcagcctgttagaagacggctttgctgagctg
gtattcgacgcccaaggttcagtaaacaagttcgaccgccaaacggtgagtgaacttgac
gaagcaactcaagccctacttgctaaaggcgatgttaaaggcttagtggtacgcagtgca
aaacctgcatttatcgtgggtgctgatatcaccgagttcactggcctattcgccatggac
gatgcagaagtactacagtgggttgccaatacatcacaagtattcgaccgcttcgaagac
ctacctttccctaccatcgctgcagttaacggcttcgctctaggtggcggctgtgagatg
gcattggcgtgtgacatgcgtattgcagacactactgcttcaattggtttaccagaagtt
aaactaggcctaatgcctggttttggtggtacggttcgtctacctcgccttattggttca
gacaatgcccttgagtggatgaccactggccgcgacagaaaaggcgcgaaagccttggct
gaaggcgcggttgatgccgttgttgcaccagaagcacttgttgaaggtgcgctttcaatg
gtgaaagacgccgctgacggtaaatttgactggcaagcgcgtcgtgcggttaagaaagcc
ccactacagctaaacaaaaacgaagccatgatgagcttcagtactgctcaagctatggta
tttgcgcaagctggcaaacactacccagcaccgcacaaaatggttgagactgttcaaaaa
gcagcgggcctagaccgtgaaggtgcacttaagcttgaaaatgaaggctttgtagcgtta
gcgaaaacagacgctgcgaaagcgcaaattggtattttcctagccgaccagctagttaaa
agcaaaggtaaaaagcaagcgaaagcagctactaagcaatctaagcttaacgctgtgcta
ggcgcaggcatcatgggcggcggtatcgcataccaaagcgctgtgaaaggcacgccagtt
atcatgaaagacattaatcaaggtgcactagaccttggcctttctgaagcagcgaaaatt
cttggtaaaggcatgcagcgcggtaaagtagacgcgactaaaatggcgcaaacacttaac
gctatcacgcctacccttgagtacagcacgcttaaagatgctgaccttgttattgaagcg
gttgtagaaaacccgaaggtaaaaggtattgtgcttaaagaggtagaggacaacgtagcg
gacgacgctatcatttgttcaaacacttctactatctctatcaatcagctcgctgaaagc
ctagacaagccagagcgcttctgtggtatgcacttctttaacccagtgcaccgcatgccg
cttgttgaaattattcgtggcgaaaaaacctctgaagaaaccatcaatgcagtagtagcc
gctacccttaaaatgggcaaaaccccaattgtggttaacgactgcccagggttcttggta
aaccgcgtattgttcccatactttgcgggcttcagtaagctacttatcgacggcgctgac
tttgttgcagttgataaagtaatggaaaaaatcttcggctggcctatgggccctgcctac
ctaatggacgttgtaggtatcgacacgggcgatcacgcagcagacgtaatggcagcgggt
attccagagcgtatggctcgcctagacaacgaccctgtaacactgttctacaaagagcag
cgtttaggtcagaagaacggtaaaggtttttacaactacggtgttgataagcgcggtaag
ccgtctaaaacacctgctgaagaagcatacgccctaatggcgccacacgtagctgagaag
acagactttgaagctgacgacattattgcacgccttatgatcccaatggcaaacgaagca
attcgctgcctagaagaaggcattgtagatagcgcagctgaagcagatatggcgctactt
tacggcttaggtttccctccattccgcggtggtatcttccgttggattgaaaccattggc
ttggcgaactttgttgcgatggcagacaagtacgctgaacttggtccaatttatcagatc
tcagacggcgttcgtgaaatggccgctgctggtaaatcctatttcgcataa

DBGET integrated database retrieval system