KEGG   Alteromonas macleodii ATCC 27126: MASE_02375Help
Entry
MASE_02375        CDS       T02246                                 

Definition
dihydrofolate reductase type I, trimethoprim resistance
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amac00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:amac00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534709..535218
Genome map
AA seq 169 aa AA seqDB search
MKIAMIAAMAKNRIIGADNDMPWHLPADLKHFKAITLGKAVIMGRKTYESIGRALPGRPN
IVITSNADYSLSDATVVDSPESAIEVAKALSAEHSDNDEIMIIGGGTIYQTFLDSTDTLY
LTHIDLTVDGDTQFPDYEAAASWTEVSRDEHDADEKNPHPYTFVTLVRN
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcgatgattgctgctatggcgaaaaacagaattataggcgcagataatgat
atgccgtggcacttaccggctgatttaaaacactttaaagcgatcaccttaggcaaagcc
gtcataatgggccgcaaaacctatgagtcaatcggaagggcattacctggcaggccaaac
attgttataacgagtaatgctgactacagcttatctgacgcgacggtagtagattcacca
gagtcagcgattgaggtagccaaagcgctaagcgcagagcacagcgacaacgatgaaata
atgattatcggtggcggtactatttaccaaacgttcttagatagcactgacactttgtat
ctcacacatattgatttgactgttgacggagatacacagttcccagactatgaggcggca
gcaagttggacggaagtatcacgtgatgaacatgacgccgatgagaaaaatcctcaccct
tacacattcgttactctcgttcgaaactaa

DBGET integrated database retrieval system