KEGG   Alteromonas macleodii ATCC 27126: MASE_02980Help
Entry
MASE_02980        CDS       T02246                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MASE_02980
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MASE_02980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
677570..678064
Genome map
AA seq 164 aa AA seqDB search
MSQHTILISIGSNIEREHYTKQSLVALKQHFSDVAVSSVYESEAVGFNGSPFYNAAARAT
TSKSIEEVCAILKAIEKDNGRVHTDKKFCARTLDLDLLTYDSKVTTTPVVLPREEICYNA
FVLWPLAELVPNDIHPETQETYAKMWQNFDKQKQQLWPIDFTWS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacacaccatcttaatcagcattggttctaatattgaacgtgagcattacacc
aagcaatctttagttgccctgaaacagcacttctcagatgtcgcagtgtcttcggtctac
gagagcgaagcggtgggcttcaatggaagccctttttataacgcagctgctcgggcgacg
acatcaaaaagtatagaagaggtgtgcgcaattcttaaagccattgaaaaagacaatggc
agggtgcatacagacaaaaaattctgtgccagaacccttgatctcgacttgcttacctat
gatagtaaggtgaccacaacccctgtggttttacctcgcgaagagatttgctacaacgcg
tttgtgctttggccgttagctgaacttgttcccaacgacattcaccctgaaacgcaagaa
acctatgccaaaatgtggcaaaactttgataaacagaaacagcaattatggccgattgac
tttacttggagttaa

DBGET integrated database retrieval system