KEGG   Alteromonas macleodii ATCC 27126: MASE_03210Help
Entry
MASE_03210        CDS       T02246                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Brite
Enzymes [BR:amac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MASE_03210
Secretion system [BR:amac02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MASE_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737129..737851
Genome map
AA seq 240 aa AA seqDB search
MKAVKKVLLASVVAAGSLLGLSAQAADEAAIRDKLTSMLGLDVETIADSPVSGLVQVSTN
RGLFYVSENGQYLLQARVFNIDEEMRNETELALSGLRKEGVKEMESSSITFKAKNEKHEI
SVFTDITCGYCRKFHNEIDELNDAGITVHYLAFPRSGLNSENYNDMVSVWCAKDPQKALT
KAKAGNDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAALLAKALEEAE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtaaagaaagtattgttagccagtgtagttgcggcaggttctctattaggg
cttagtgcgcaagcggctgatgaagcggctatccgtgataaattaacctcaatgctaggg
ttagatgtagaaactattgctgactctccagtatcagggctggttcaggtatcaacaaac
cgcggtttattttacgtaagtgaaaacgggcagtatctgcttcaggctcgtgtttttaac
attgatgaagagatgcgtaacgaaacagagctggcactttctgggctgcgcaaagaaggc
gtaaaagagatggaatcatcgtctattacgtttaaggccaaaaacgaaaagcatgaaata
agcgtatttactgatattacgtgtggctattgccgtaaatttcacaacgagattgatgaa
ctcaacgatgcgggcatcaccgtacactaccttgcgtttccacgttctgggttaaacagt
gaaaactacaacgatatggtgtcggtgtggtgtgcgaaagacccgcaaaaagcgttaact
aaagctaaagcgggtaacgacgtagctagcgcaagctgtaaaaataaagtggcagagcag
tacatgttgggtcaaaaattaggcgtgaatggcacgccaaatatcgtactgccagacggt
tcattgattcctggttatcagccagctgcgttgcttgctaaagcattggaggaagctgaa
tag

DBGET integrated database retrieval system