KEGG   Alteromonas macleodii ATCC 27126: MASE_03980Help
Entry
MASE_03980        CDS       T02246                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920106..921155
Genome map
AA seq 349 aa AA seqDB search
MILGACSKSPTPYTWNLPHNIPPPPVPADNPVTEESVILGEKLFFDKGLSANNTVSCSSC
HEPEHAFSEPKTVSVGANGDALNRNALALVNVAYNASFTWAHNNLESIEKQLMIPLFNEH
PVEMGVTGNEKRILKRFEGSEYRALFEAAYGDDTPNLNNIVKALASYVRSLVSFNSAFDN
YAYAQDDDALTAQQLEGLNLFFSERTECFHCHGGLNFTQSSKHSFQPFAAQPFHNTGLYN
EDGKGSYPESDMGLYSVTHNKQDMGKFRAPTLRNIALTAPYMHDGSIATLDEVIEFYARG
GNLAESPNPYRSPFIKGFTISEDEKAALVAFLRSLTDEQFVKTHTTRKN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgattttaggagcgtgcagtaaatcgcccacgccctacacttggaatttgcctcacaat
attccaccgcctcccgttcccgcagacaatcctgtgaccgaagaaagcgtaattttggga
gagaagcttttctttgataagggcttaagtgctaacaacacggtttcatgcagcagctgc
catgaaccagagcatgctttctctgaacctaagacggtttcagtaggcgcgaatggagac
gcgctaaaccgtaacgcattagcgctagtaaacgtggcttataatgcatccttcacttgg
gcgcataacaatttagaaagtatagaaaagcagctgatgatcccgctttttaatgaacat
ccggtggaaatgggcgttacgggaaatgaaaagcgtatattaaagcgctttgagggcagc
gaatatcgagcgctttttgaagcggcttatggtgatgatacacccaatttaaacaatatt
gtaaaggcgcttgctagctacgtgagaagtttagtgtcgtttaatagtgcttttgataac
tacgcttacgctcaagatgacgatgcactaaccgcccagcagcttgaaggtttgaatctg
tttttttcagaacgcactgagtgctttcattgccacggaggtctgaacttcactcaatcg
tctaagcatagttttcaaccttttgcggctcagcctttccacaacactggcctgtataac
gaagatgggaagggcagttatccggaatcggacatgggactttacagcgttacccacaat
aaacaagacatggggaagtttagagcacctactttgcgcaatatagcccttactgcgccc
tacatgcatgatggcagtattgccacccttgatgaagtcattgagttttatgctcgtggg
ggaaatctggctgaaagccctaacccttaccgcagtccgttcataaaaggctttacgatt
tctgaagatgaaaaggcggcgttggttgcatttttgcgcagtttaaccgacgagcaattt
gtaaaaacacacactacacgcaaaaattag

DBGET integrated database retrieval system