KEGG   Alteromonas macleodii ATCC 27126: MASE_04960Help
Entry
MASE_04960        CDS       T02246                                 

Definition
chemotaxis-specific protein-glutamate methyltransferase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amac00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MASE_04960
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MASE_04960
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MASE_04960
Two-component system [BR:amac02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MASE_04960
Bacterial motility proteins [BR:amac02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MASE_04960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158020..1159150
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVKEILDGDRELEVVGEARNGRDALEKAEALKPDVITMDVEMPV
MDGISAVKAIMDKRPTPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDASR
LLCTKVRLIARRGIGLKRPSFRSTEARKLPDNAPKQAFFKTSGLLSGHKDAAKQPTVSSV
RATGKHYKCLAIGASTGGPVALQKVLSPLPAEFPYPILLVQHMPGTFTTAFAQRLDTNCK
IRVKEAEHGDILKPGHAYLAPGGKQMLLETIGANKRIAIVDASASDKVNYKPSVDLTFSS
LAKAYGGDVLGIILTGMGADGREGCRMLKEKGATIWAQDQDSCVVYGMPQAVAVANISSK
NINIDDMSSCVQTEMR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtccttgtcgtggacgactcgactttttatcgtcgtcgagtaaaagaa
atactcgatggcgatagggaacttgaagttgttggggaagcgagaaatgggcgcgatgca
cttgaaaaagcagaagcgcttaagccggatgtgataacgatggatgttgaaatgcctgtc
atggacggcatttcagctgtaaaggccataatggacaaacggcctacacctattcttatg
ttttcttcgcttacgcatcatggtgcgcaagcgacattagatgcgttagaagcgggcgcg
ctcgatttcttacctaagaaatttgaagatatcgcgcaggacagaaaagacgcatcgcgc
ttgttgtgtacaaaagtacgcttaatagcgcgtcgtggtattggtcttaagcgtccgtcg
tttcgctctacagaggcaagaaagcttcctgataatgcgccaaagcaggcgttttttaaa
acatcagggttgctatcagggcataaagacgcagctaaacaaccaaccgtttcgtctgta
agagcgacgggaaagcactacaagtgtttggcaattggggcttctacaggcgggcctgtg
gcgcttcaaaaagtgctgtctcctttacctgcagagtttccataccccattttgcttgta
caacacatgccaggaacatttactacggcatttgcacagcgtttagacacaaactgtaag
attagagtaaaagaagccgagcacggcgacattctaaaaccaggtcatgcgtatcttgct
cccggtgggaagcaaatgttgctagaaaccataggtgcgaataaacgcattgccattgtt
gatgcaagtgcgagtgacaaggtgaattataagcccagtgttgatctcactttcagttct
ctggctaaagcttatggtggggatgtattaggaattatattaacgggtatgggggctgac
ggcagagaaggatgccgaatgctcaaggaaaaaggcgcaacgatttgggctcaagaccaa
gattcctgtgttgtgtacggtatgcctcaagctgtagccgttgccaatatatccagtaaa
aatataaacattgatgatatgagcagttgcgttcaaaccgaaatgcgatag

DBGET integrated database retrieval system