KEGG   Alteromonas macleodii ATCC 27126: MASE_06065Help
Entry
MASE_06065        CDS       T02246                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amac03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1417612..1418232
Genome map
AA seq 206 aa AA seqDB search
MIGRIRGTLAEKQPPEILVDVAGVGYEIHMPMTSFYQLPAVGEEVVVYTHFVVREDAQLL
FGFADKMERGLFRELIKANGVGPKLGLAILSGMSASQFLASVQNEDVSALVSLPGIGKKT
AERLVVELKDRLAKFGKAQSIAVPPPSGDLLSTNTIVAVNDAREEAQSALIALGYKPAQA
SKLVDSVYKEGMESEALIRESLKAAI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgaattcgcggtacgttggctgagaaacagcctccagaaattcttgtagat
gtagccggtgttggctacgaaattcacatgcctatgaccagtttctaccagcttcccgcg
gtgggtgaagaagtggtggtgtacacacactttgtggttcgtgaagacgcccaattgctg
tttggttttgctgataaaatggaaagagggcttttccgagaattgatcaaagccaatggt
gtaggtccaaaattaggccttgctattttatctggaatgtcggcaagccagttcttggca
agtgtacaaaatgaagatgtttctgcactcgtcagcttaccgggtataggtaagaaaacc
gcagagcgtttagtggtagagcttaaagaccgcctagcaaaatttggtaaggcgcagagt
attgctgtaccgcccccaagtggcgacttgctatccaccaacactattgttgctgtaaac
gacgctcgggaagaagcgcaaagcgcgcttattgcactgggctataaacctgctcaagcg
agcaagctagtcgacagcgtatataaagagggcatggaaagtgaggcccttattcgcgaa
tcattaaaagcggccatataa

DBGET integrated database retrieval system