KEGG   Alteromonas macleodii ATCC 27126: MASE_06455Help
Entry
MASE_06455        CDS       T02246                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MASE_06455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MASE_06455
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MASE_06455
Enzymes [BR:amac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MASE_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505139..1505948)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFAGLDKKNQGAFVPFVMVGDPDLAQSEAIICQLVESGADALELGIPYSDPIAD
GPTIQASAIRALSNKVTVADCLGVISRVRAKYPNVPIGLLLYSNLVMAQGIENFYNKAQE
AGVDSILVADVPIREAAPFQKAAEATGISQILIAPPNATDETMEKIGEYSKGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGSFVESMKAATAKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggatagatatgcacaaatgtttgccgggcttgataaaaagaaccaaggcgctttcgta
ccttttgtaatggtaggtgaccccgatttagcgcaatctgaagccattatttgccagctg
gtagaaagcggtgctgacgcacttgagttaggtataccttactctgaccccatcgccgac
ggccccacaatccaagcttctgccattcgcgcattaagtaataaggtgacggtagcagat
tgcttgggcgttatttcacgtgttcgcgcaaaatatcctaatgtgcctatcggcttgcta
ctgtacagcaacttagtaatggcccaaggtattgagaacttttacaataaagcgcaagag
gcaggcgttgactcaattttggtcgctgacgttcctattcgcgaagcggcaccttttcaa
aaagcagccgaagccactggcatttcacaaattctgattgcaccacctaatgctactgac
gaaaccatggaaaaaatcggggaatactcgaaaggttacacgtatttgctgggtcgtgct
ggcgttactggcgcagaaactgccgcaaacgtgcctgcttcagagcttattgagcgcttg
aacaaacacaaagcagcaccagcattgttaggttttggtatttctacaccggaacaggtt
aaatctgctattgacgctggtgccgctggcgcaatttcaggctcggcgacagtgaatatt
atcgctgccaatttatcggacagtcacaaaatgctaagcgagctcggcagctttgttgaa
agcatgaaagccgctacggcgaaaggataa

DBGET integrated database retrieval system