KEGG   Alteromonas macleodii ATCC 27126: MASE_06465Help
Entry
MASE_06465        CDS       T02246                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01130  Biosynthesis of antibiotics
amac01230  Biosynthesis of amino acids
Module
amac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MASE_06465
Enzymes [BR:amac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MASE_06465
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     MASE_06465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI FMN_dh QRPTase_C TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AFS36836
Position
complement(1507150..1508559)
Genome map
AA seq 469 aa AA seqDB search
MANVLEKIVADKREEVAARKEALPLESFKANLVPSEKSLFAALSEPNAGFIFECKKASPS
KGLIREHFDLDEILAAYTPYAAGISVLTDEKYFQGKFEYLAYVTERVAQPVLNKDFFVDT
YQVYLARHYNADAVLLMLSVLNDDEYRELASVANALSLDILTEVSNEEEMERAIALEANI
IGINNRNLRDLSTDLATTELLVPMLEKATHDYVVISESGIYTHQDVLRLAPVSQGFLVGS
ALMAEADLPRAVKTLVNGAVKVCGLTNPEQAQMAFDKGASFGGLIFAEKSPRYVSEAQAL
TITQSIDGAFVGVFVNHDIDEVASLAALLNLFAVQLHGSEDDTYISALAAKLPEGCEIWK
VEGVKATSSGALPDAVDRHLKNSLVSRVLLDCQVGDAKGGTGEAFNWQLLNDIEAKHKLV
LAGGINAQNVAEAIATGCGAIDVNSGVETAPGVKSEEKLDALFAICRRY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtgcttgagaaaattgttgcagacaaacgagaagaagtggccgcacgcaaa
gaagcactgccgctggaaagcttcaaggcgaatctagttccttccgaaaagagtttattt
gccgcacttagtgagccaaacgcaggctttatcttcgaatgcaaaaaagcatcgccttca
aaaggtcttattcgagagcatttcgatttagacgagatcttagcggcttacacgccttat
gctgccggtatttctgtgctgacagacgagaagtacttccaaggtaaatttgagtactta
gcttatgttactgagcgtgttgctcagcctgtgcttaacaaagatttcttcgttgatacc
tatcaagtgtatctagcccgtcactataatgccgacgcagtgctattaatgcttagtgtg
ctaaatgatgacgaatatcgcgagttggcaagcgttgccaatgctctgtcattagacatt
cttaccgaagtaagtaatgaagaagaaatggagcgcgctattgcccttgaagccaacatc
attggtatcaataatcgcaacttacgcgacctttctaccgatttagccacaaccgaactc
cttgtgcccatgcttgaaaaagccacgcacgactacgtggttatttcagagtcgggcata
tacacacatcaagacgtgcttcgtttagcgcctgtatcccaaggctttttggtgggcagt
gcgttaatggcagaggctgacctaccgcgcgctgtgaaaacgttagtgaatggcgcagtt
aaagtgtgcgggcttaccaaccccgaacaagcgcaaatggcgtttgataaaggcgctagc
tttggcgggcttatcttcgctgaaaaatcgccacgctatgtgagcgaagcacaggctttg
actataacgcagagcattgacggtgcttttgttggtgtgttcgttaatcacgacattgat
gaagtggcatcactcgccgccttgctcaacctttttgccgtgcagcttcacggcagcgaa
gatgacacctacatttcagcgcttgctgccaagcttccagaaggttgtgaaatttggaaa
gtcgaaggtgttaaagcaacctcttctggcgcactaccagacgcagtggacagacactta
aaaaatagccttgtaagccgtgttcttctggattgccaagtgggtgatgccaaaggcggt
acaggcgaagcgttcaactggcaactattaaacgatatcgaagcgaagcataagttagtg
cttgctggcggtattaacgcccagaatgttgcagaagctattgcaaccggctgtggtgct
attgatgtgaattcaggcgtagaaaccgcacccggcgtgaaaagcgaagaaaaactcgac
gcgctttttgccatttgccgccgttactaa

DBGET integrated database retrieval system