KEGG   Alteromonas macleodii ATCC 27126: MASE_08685Help
Entry
MASE_08685        CDS       T02246                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MASE_08685
Enzymes [BR:amac01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MASE_08685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043008..2043832
Genome map
AA seq 274 aa AA seqDB search
MQFGKYFIGLSQPQVMGILNVTPDSFSDGGKHTNVSQALDHALRMIEEGATFIDIGGEST
RPGAPDVSLQEELDRTIPVIEAVAKNTPCVISIDTSKADVMREAVKAGAGLINDVRALQE
PGALQVAAEAQVPVCLMHMQGQPRTMQQSPEYDDVVNDVGQFLLARTKVCEEAGIAKDKI
LFDPGYGFGKSLEHNYTLVKHLPSLMKLGYPVLVGMSRKSMIGNLLNRKVDERLAGSISL
ATIVAQMGAQIIRVHDVKETADAVNIVKMLNSVK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttggtaagtacttcataggtctgtcacagcctcaggtaatgggcattttaaat
gttactcctgattcattttctgacggcggcaagcacacaaatgtatctcaagcccttgac
catgcgcttcgcatgattgaagaaggggcaacttttattgatataggtggtgaatcgaca
aggccaggcgcgcccgacgtatcgctgcaggaagagcttgaccgcacaatacccgttatt
gaagccgtagctaaaaataccccatgtgttatttctattgataccagcaaggctgacgtt
atgcgggaagcggtgaaagccggcgcggggctaatcaacgatgtacgcgcgttacaagag
cctggtgcattgcaagtagcagctgaagcacaagtacctgtttgtttaatgcatatgcag
gggcaacccagaaccatgcagcaaagccctgagtatgatgatgtagtgaatgatgtgggt
cagtttctactcgcgcgcaccaaagtgtgtgaagaagcgggcattgctaaagacaagatt
ttgttcgaccctggctacggtttcggaaagtcactggaacacaattatacgctggtgaaa
cacttgccatcgcttatgaagctgggttacccagtgttagtaggcatgtctcgcaagtcg
atgattggcaatttgctaaatagaaaagtggatgagcgcttggcgggaagcataagcctc
gctacaattgtcgcccaaatgggcgcacagataattcgcgttcacgacgtgaaagaaaca
gctgatgctgtcaatatcgtgaaaatgctgaattcagtaaaataa

DBGET integrated database retrieval system