KEGG   Alteromonas macleodii ATCC 27126: MASE_08695Help
Entry
MASE_08695        CDS       T02246                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MASE_08695
   01230 Biosynthesis of amino acids
    MASE_08695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MASE_08695
   00051 Fructose and mannose metabolism
    MASE_08695
   00562 Inositol phosphate metabolism
    MASE_08695
Enzymes [BR:amac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MASE_08695
Exosome [BR:amac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MASE_08695
  Exosomal proteins of bladder cancer cells
   MASE_08695
  Exosomal proteins of melanoma cells
   MASE_08695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045282..2046025
Genome map
AA seq 247 aa AA seqDB search
MSKNLRKPFVAGNWKMNGNLALVAEFNQKLANVKADSEIVICAPSLLLHAFETHSFAIGA
QNVSHLNNGAHTGELSVEMLKEAGCGYAIVGHSERREDQGESSELVALKAKQCVSSGVVP
IICVGEPLEVREADDVESFVGEQLDALVSAMSVDELSKTVIAYEPIWAIGTGKTASPEQA
QEVHEFIRGYFNKVDAQLAQGLRILYGGSVKPDNAETLFAQKDVDGGLIGGASLKAEDFI
SICQAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaatcttagaaagccattcgtggctggcaactggaaaatgaacggaaatttg
gcattagttgctgaatttaatcaaaaactggcgaatgtaaaagctgattcggaaatcgta
atttgcgctccttcacttcttttacacgcatttgaaacccattcgtttgccattggtgct
caaaacgtaagtcatcttaataacggcgctcacactggtgagttgtcagttgaaatgctt
aaagaagcaggttgcggttacgcaattgttgggcattcagaaagacgagaagaccaaggc
gagtcaagcgaacttgttgcattaaaggcaaagcaatgtgtttcttcaggtgtcgtaccc
atcatttgtgtaggtgagccacttgaagtgagagaagcagatgatgttgaatcgtttgtt
ggtgagcaactagatgcactagttagcgccatgtcggtagacgaactcagcaaaactgtt
attgcatacgagccgatttgggcaattggtactggtaaaacagccagccctgagcaagca
caagaagtacacgaatttattcgcggctactttaataaagtagacgcacaattggctcaa
ggccttcgtattttgtacggtggtagtgttaagccagataatgctgaaaccctatttgca
cagaaagatgttgatggcggtttaattggcggagccagtttaaaagctgaagattttatt
tcaatttgccaagcggcaaactga

DBGET integrated database retrieval system