KEGG   Alteromonas macleodii ATCC 27126: MASE_09090Help
Entry
MASE_09090        CDS       T02246                                 

Definition
succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with sdhC
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MASE_09090
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MASE_09090
   00650 Butanoate metabolism
    MASE_09090
  Energy metabolism
   00190 Oxidative phosphorylation
    MASE_09090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2123907..2124254
Genome map
AA seq 115 aa AA seqDB search
MVTNQASIKRDGVQDYVSLRATAAIIFAYSVFMAWFFITTDNLTFIEWRGLFSGLAMKVF
TLAALVAVMIHVRIGLWQVLTDYVKSAGLRAGLQYILNIIAFGYVAVGLFVLWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaaccaagcaagcattaagcgtgacggcgtacaagactacgtttcacttcgc
gctacagcagcaattattttcgcgtactcggttttcatggcgtggttctttattaccacc
gataacctaacgtttatcgaatggcgagggttgttctctggcctggctatgaaagttttc
acattggcagcactagtagcagtgatgatccacgtgcgcatcggcctttggcaggtgctt
acagactatgttaaatcagcaggtctgcgcgcaggactacaatatatcttaaatatcatc
gcgttcggctatgtagctgttggcctattcgtattgtggggagtgtaa

DBGET integrated database retrieval system