KEGG   Alteromonas macleodii ATCC 27126: MASE_09110Help
Entry
MASE_09110        CDS       T02246                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:amac01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:amac00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:amac00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129759..2131270
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAPAEAKTESKAKDDSKSDAAPAASGKTSDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEIIAEEGATVTAEEVI
AKFVEGAASGASAPAASSESDDSDESSDALSPSVRRLLAEKGVDAAKVKGTGKNGRITKE
DVEKYLKGGDSSAKAAPAASESVSADLPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQDSFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgtaaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaactgttttaggcgagcaagttattgctaaactagaaaagggtggt
gctgctgcaccagctgaagctaaaacagaaagcaaagcgaaagacgattctaaatcagat
gcggctccagcggcttctggaaaaacatctgatgttaaagtaccagtacttcctgaatct
gtagctgacgcgacaatcgcaacgtggcacgtagctgtaggtgaagcagtttctcgcgac
caaaacttggttgatatcgaaactgataaagtagtactagaagttgttgctcctgcagac
ggttctcttgctgaaattatcgcagaagagggcgccaccgtaacagctgaagaagtgatt
gctaaatttgtagaaggtgcagcaagcggcgcttctgctccagcagcgtcaagcgaaagc
gatgacagtgacgagagcagcgatgcgcttagtccttctgttcgtcgtttacttgcagaa
aaaggtgttgacgcagctaaagtgaaaggcactggtaaaaatggccgtatcactaaagaa
gacgtagagaagtaccttaaaggcggcgacagctcagcgaaggcagcgcctgctgcgtct
gaatctgtttcagctgacttaccaacgggtaatcgtaccgagaagcgtgttcctatgacg
cgtcttcgcaagacaattgctaaccgtcttcttgaagcgaagaactctacggcaatgcta
acaacgtttaacgaagtaaacatgaagccaatcatggaccttcgtaagcagtatcaagac
agcttcgagaagcgtcacggtattcgccttggtttcatgtctttctacgtgaaagcggta
accgaagcccttaagcgtttccctgaagttaacgcgtctatcgacggtgatgacattgtt
tatcacaactacttcgatgtatcgattgctgtttctacaccacgtggccttgtaacacca
gtacttaaagatactgacacactaggcatggcaggcgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcattggctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcactaatgtctacaccaatcattaacccgccacag
agcgctattttgggtatgcataaaatccaagatcgtccaatggcagttaatggaaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcagtaggtttcttggtaaccgttaaagagatgctagaagatccaacacgtctactt
ctagacgtataa

DBGET integrated database retrieval system