KEGG   Alteromonas macleodii ATCC 27126: MASE_09115Help
Entry
MASE_09115        CDS       T02246                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:amac01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:amac00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:amac00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:amac00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2131423..2132589
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEYGLPVSEGYAADTAQGAVEAADRIGGNEWVVKCQVHAGGRGKAGGV
KLVKNKDDIRAFAENWLGKNLVTFQTDENGQPVSKILVESCTDIANELYLGAVVDRTTRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPIVGPQPYQAREMAFALGLSGVQIKQFTQI
FLGLAKMFEELDVALIEINPLVIKTDGNLHCLDAKVGIDGNALYRQPKLKDMQDPSQEDA
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVEVPVVVRLEGTNAELGREV
LANSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaaggtaagcagctattcaaagaatacggtttgcctgtttct
gaaggatacgcagcagacactgctcaaggtgctgtagaagccgctgaccgaattggcgga
aacgagtgggtagttaagtgtcaggtacacgcgggcggtcgcggtaaagctggcggtgta
aagctagttaaaaacaaagacgacattcgcgctttcgctgaaaactggcttggcaaaaat
ttggtgactttccagactgacgaaaacggtcagcctgtgagcaaaatcctagttgaatct
tgcacagatatcgctaacgagctttaccttggtgcagtagttgaccgtacaacccgtcgc
gttgtattcatggcatctactgaaggtggcgttgagattgaaactgttgcagaagaaact
ccagagaaaatccttaaagctgaaatcgacccaattgtaggtcctcagccttatcaagcg
cgcgaaatggcgtttgctctaggtctttctggcgtacaaatcaagcaattcactcaaatc
ttccttggcctagctaagatgtttgaagagcttgacgttgcgcttatcgaaatcaacccg
ctagttatcaaaactgacggtaacctacactgcctagacgcgaaagtaggtatcgatggt
aacgcgctatatcgtcagcctaagctgaaagatatgcaagatccttcacaagaagatgcg
cgtgaagctcatgctgctcagtgggaactaaactatgttgcgctagacggtaatgtaggt
tgtatggttaacggtgcaggcctagcaatgggtacgatggacatcgtaaacctacacggt
ggcaagccagctaacttcctagacgttggtggcggcgcaactaaagagcgtgtagctgaa
gcattcaaaatcatcctttctgatgacaatgttaaagcggtattggttaacatcttcggt
ggtatcgttcgctgtgacatgattgcagaaggtatcattggtgcggttaaagaagttggc
gtagaagtacctgtagttgtacgtcttgaaggtaccaatgcagagcttggccgtgaagtt
ctagcgaactctggtctagatatcattgctgctgaatcgctaactgatgcagcgcagaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system