KEGG   Alteromonas macleodii ATCC 27126: MASE_09410Help
Entry
MASE_09410        CDS       T02246                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MASE_09410
   01230 Biosynthesis of amino acids
    MASE_09410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MASE_09410
   00030 Pentose phosphate pathway
    MASE_09410
   00051 Fructose and mannose metabolism
    MASE_09410
   00052 Galactose metabolism
    MASE_09410
  Energy metabolism
   00680 Methane metabolism
    MASE_09410
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MASE_09410
Protein phosphatases and associated proteins [BR:amac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MASE_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2218249..2219253)
Genome map
AA seq 334 aa AA seqDB search
MSKRVAILTSGGDAPGMNACIRAAIIACQKANFTLLGYKHGYNGLLQQEFIPLSLDSTHN
LIQQGGTILHSARCKEFKNREGLIKAADNLRQAEIDTLIVIGGDGSFRGAAKLSELWDGQ
ILGIPGTIDNDIAGTDATIGYFTAIDTAMSSIDKVRDTADAFERIFLVEVMGRNAGFLAL
NGALSAAADYVVVPEFFESAETEIKKIVNQIKAQRALKGPVSFIVVVAENVWPNGLTGLT
EALQYHNINDVRPVTLGHVQRGGSPVAQDRLLATTLGEFAISLVGSDVTNIMVGEVNQRP
ITVPLPKTWEETKPLNQARVDAMRTLMNERYSCD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacgtgtcgcaattttaacctctggtggcgacgccccaggtatgaatgcatgt
atacgtgccgcaattattgcgtgtcagaaagctaattttaccttgcttggctacaagcac
ggctacaacggattactacagcaagagtttattcctctatctcttgattcaacgcacaat
cttatccagcaaggcggcaccatactacacagcgcaaggtgtaaagaatttaaaaatcgt
gaagggcttataaaagcggctgataacttgagacaggccgagatcgacacacttattgta
atcggtggtgacggatcttttcgcggcgcagcaaagttgagcgaactatgggatggccag
attcttggtattccgggaacaattgataacgatatagcgggcactgatgccactataggc
tactttaccgcaatagataccgccatgagttctatcgataaagttcgtgatacagctgat
gcgttcgaacgtattttccttgtagaagtaatgggtcgcaatgctggctttttagcatta
aatggtgccctttccgctgcggctgactatgtggttgttcctgagttttttgaatccgct
gagactgaaatcaaaaagatcgtaaaccagataaaagcgcagcgtgctttgaaagggccc
gtcagttttattgttgtagtagctgaaaacgtttggcctaatggcttaacaggattaacc
gaagctttgcagtatcacaatatcaacgacgttaggccagtaaccttgggacatgtccaa
cgtggcggctcgccggtagcacaggatcgactactcgccactactcttggcgaattcgcc
ataagcttagtaggaagcgacgtcaccaacataatggttggtgaagttaatcagcgccct
attaccgtacccctacccaaaacttgggaagaaacaaagcccctcaatcaagcccgggtt
gacgctatgcgcaccctaatgaacgaaagatacagctgcgactaa

DBGET integrated database retrieval system