KEGG   Alteromonas macleodii ATCC 27126: MASE_09410Help
Entry
MASE_09410        CDS       T02246                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac00010  Glycolysis / Gluconeogenesis
amac00030  Pentose phosphate pathway
amac00051  Fructose and mannose metabolism
amac00052  Galactose metabolism
amac00680  Methane metabolism
amac01100  Metabolic pathways
amac01110  Biosynthesis of secondary metabolites
amac01120  Microbial metabolism in diverse environments
amac01130  Biosynthesis of antibiotics
amac01200  Carbon metabolism
amac01230  Biosynthesis of amino acids
amac03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MASE_09410
   00030 Pentose phosphate pathway
    MASE_09410
   00051 Fructose and mannose metabolism
    MASE_09410
   00052 Galactose metabolism
    MASE_09410
  Energy metabolism
   00680 Methane metabolism
    MASE_09410
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MASE_09410
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MASE_09410
Protein phosphatases and associated proteins [BR:amac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MASE_09410
Messenger RNA biogenesis [BR:amac03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MASE_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Glycos_transf_1
Motif
Other DBs
NCBI-ProteinID: AFS37413
Position
complement(2218249..2219253)
Genome map
AA seq 334 aa AA seqDB search
MSKRVAILTSGGDAPGMNACIRAAIIACQKANFTLLGYKHGYNGLLQQEFIPLSLDSTHN
LIQQGGTILHSARCKEFKNREGLIKAADNLRQAEIDTLIVIGGDGSFRGAAKLSELWDGQ
ILGIPGTIDNDIAGTDATIGYFTAIDTAMSSIDKVRDTADAFERIFLVEVMGRNAGFLAL
NGALSAAADYVVVPEFFESAETEIKKIVNQIKAQRALKGPVSFIVVVAENVWPNGLTGLT
EALQYHNINDVRPVTLGHVQRGGSPVAQDRLLATTLGEFAISLVGSDVTNIMVGEVNQRP
ITVPLPKTWEETKPLNQARVDAMRTLMNERYSCD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaacgtgtcgcaattttaacctctggtggcgacgccccaggtatgaatgcatgt
atacgtgccgcaattattgcgtgtcagaaagctaattttaccttgcttggctacaagcac
ggctacaacggattactacagcaagagtttattcctctatctcttgattcaacgcacaat
cttatccagcaaggcggcaccatactacacagcgcaaggtgtaaagaatttaaaaatcgt
gaagggcttataaaagcggctgataacttgagacaggccgagatcgacacacttattgta
atcggtggtgacggatcttttcgcggcgcagcaaagttgagcgaactatgggatggccag
attcttggtattccgggaacaattgataacgatatagcgggcactgatgccactataggc
tactttaccgcaatagataccgccatgagttctatcgataaagttcgtgatacagctgat
gcgttcgaacgtattttccttgtagaagtaatgggtcgcaatgctggctttttagcatta
aatggtgccctttccgctgcggctgactatgtggttgttcctgagttttttgaatccgct
gagactgaaatcaaaaagatcgtaaaccagataaaagcgcagcgtgctttgaaagggccc
gtcagttttattgttgtagtagctgaaaacgtttggcctaatggcttaacaggattaacc
gaagctttgcagtatcacaatatcaacgacgttaggccagtaaccttgggacatgtccaa
cgtggcggctcgccggtagcacaggatcgactactcgccactactcttggcgaattcgcc
ataagcttagtaggaagcgacgtcaccaacataatggttggtgaagttaatcagcgccct
attaccgtacccctacccaaaacttgggaagaaacaaagcccctcaatcaagcccgggtt
gacgctatgcgcaccctaatgaacgaaagatacagctgcgactaa

DBGET integrated database retrieval system