KEGG   Alteromonas macleodii ATCC 27126: MASE_10300Help
Entry
MASE_10300        CDS       T02246                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MASE_10300
Enzymes [BR:amac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MASE_10300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2424569..2426323
Genome map
AA seq 584 aa AA seqDB search
MAWDHLHDKVKHHLESIYADVSLDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEDD
IIMITYGDSVIDEGERPLVTLNKFLHRYCKNTVNNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEVIAEDYGLMTDLVINHCSARSVWFDNFVKGEGPGSDFFFTADPSDDLSMVT
RPRVSPLLRETETASGTKHVWCTFSHDQVDFDFRNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNCINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVTGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
DEEISELVHTMQHFGGKVSWRASDHGQQKPYEINITLFDALQGTTKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLQLGNQLFGYWRQSLDRKQSIFCISNISDEEQTIL
LSDINLIGTDNWIDLITRDEIALSSGFLQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggaccatctccatgacaaagtaaaacaccatttagaaagcatttatgccgat
gtatcgcttgacgtctcgtatgagacgctagcgactgagttaatgaacactataggcatt
cagcagcaaacggatattgcttcacctcagtctcatcacaattattgggatgaagatgac
attatcatgattacctacggtgatagtgtcattgacgaaggggagcgcccgctggttacg
ttaaataagtttttgcaccgctactgcaagaacaccgttaataatgttcacatcctgccc
ttctttccgtacagctcagacgatgggttttcggttatcgactactctacggtgaatgaa
gcactagggtcatgggacgatattgaagtcattgctgaggattatggcttgatgaccgac
ctagttatcaatcactgctctgcaagaagcgtgtggtttgataactttgtgaagggtgaa
ggaccaggatctgactttttcttcacagcagatccatccgatgacctctccatggtaact
cgccctcgtgtgtcgcctttgctgcgagaaacggaaaccgccagcggtacaaagcatgta
tggtgcacatttagtcacgaccaagttgactttgactttagaaaccccaaggtgttgtta
gcgtttatcgatatcatcaagctttatattgataaaggcgctaaaatctttcgcttagac
gcagtggcatttctttggaaaattgtaggtacaaactgcattaatctattccaaacccac
gaagtcatacgtttgatccgaacgctgattgaacatgtggatccttccatcataatcatt
accgaaaccaatattcccaacagggaaaacctaacgtactttggtaatgctaacgaagcc
catgctatctacaacttttcgcttccgccgttacttgtaaatacattagtaacgggtgat
tgtacgtatttgaaaagctggatgatgagtatgccaccggcgcaaaacggcacagcctac
tttaactttatcgcttcgcacgatggtattggcttgcgtccggcggaaggcctactgtca
gatgaagaaatttcagagcttgtgcatacaatgcagcactttggcggcaaggtgtcgtgg
cgcgcttctgatcacggtcagcaaaagccttacgagataaacatcaccctgttcgacgcg
ctgcaaggaaccaccaagggccctgataagtatcaagtggatcgatttatttgtgctcac
gccataatgttaggtatggaaggtataccaggaatttacattcacagtttactcggcaca
tccaacgattacgaaaaagtcgctaatacaggacaaaatcgttcaatcaacagaaaacgt
tgggactttaacgagttagaggctctgttagactcgcccttttcacagcatcataaagta
ctcactcgaatctcgcagcttatacgcatacgtaaagcgcagcccgcatttcaccccaat
gcaacgcagtttacattgcagcttggtaatcaattatttggctactggcgacaaagtctc
gatagaaagcaaagtattttctgtattagtaatatttcagacgaagaacaaacaattttg
ctgtctgacataaatcttattggcacagataattggattgatctcatcacccgtgacgag
atagccctttctagtggtttcttacaaatgaagccttatcaagtgctttggatcagcaac
caagattttgaatga

DBGET integrated database retrieval system