KEGG   Alteromonas macleodii ATCC 27126: MASE_10935Help
Entry
MASE_10935        CDS       T02246                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MASE_10935
Enzymes [BR:amac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MASE_10935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2553960..2556167)
Genome map
AA seq 735 aa AA seqDB search
MKSNQHSVPSFFDNLFGIEAIDKFVAKEFGFIDELEQEEQFIWAGILAYLSYMQRNGHSC
IYLKDIAGTTLFKEVVAEQEAVLAAETNVHSNNGAVGASKSPVEQTEQEKAPKAGVDVPQ
LTPLLRIVKSALSNEQVAQLFVYSNGKLYSRRYYEFEQEVARNVVKRAALTPLSDEASEK
VKQLWPAIFPTETTDRQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDAVLNNVPTDAVTLHRLLGLREHGVSTK
FNQHNQLAADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
STEAASFDENANVPNGTNSLNSNDNAFSLGGVPSLMRQHIATLCPHLPLLPVDEQAKSYV
ATLQAPQRFKGQVAKVATAIQRGDASGALAAITDKASDNDETAGLNSNIDSTLVSKTASR
LQSGVHLWPEHQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPVRKGGMGVEG
LNNLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSKGKLYAWFYQD
SQASGQNGSSQKASANAGDSADKTLAQKQALRSISLSRVPQFETVYAMTIHKSQGSEFNQ
VVLILPKPDSEKAANLFHRGLVYTGLTRAKDGCLIISDTATFSHMVQRVDKRYSGMSEAI
SLHLESTSNATPEIE
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaatcaacactctgtaccgtcattttttgataacttgtttggcatcgaggcg
atcgacaaatttgtcgcaaaagaatttggctttattgatgaactggagcaagaagaacag
tttatttgggctgggatcttagcatacttgtcgtatatgcagcgcaatggccacagctgt
atctatctaaaagacatagcgggtacgacgctttttaaagaggtagtagcagaacaagaa
gcagtcttggcggccgaaacaaatgtgcatagcaataacggagcggttggggcatctaag
tcgccggtagaacaaaccgagcaggaaaaagcgcccaaagcaggtgttgacgtgccacaa
ctaacgccgttacttagaattgtaaaaagcgcgctgagtaacgagcaggtggctcaactg
tttgtctatagcaacggcaagctgtacagccgtcgctactatgaatttgaacaagaagta
gcacgaaatgttgtaaaacgagcggcgcttacgcccttaagtgatgaagctagcgaaaaa
gtaaagcaactttggccagcaatctttcctaccgaaacaaccgaccggcaagattggcag
caaatagcagtggcgaaaagcctaatgcagcgcttttgcgttataaacggtgggccagga
acaggtaaaacctatactgtattgcgcttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcagcgcctacaggtaaagcgcaacagcgtatgacggagtctatc
atgaacagcatagacggacttcgcggcaagttggacgacgcagtacttaacaacgtgcct
accgatgctgtgacgctacatagattactaggattgcgcgagcacggtgtatcgactaag
ttcaatcagcacaatcaattggcagcagatgtactcattgtcgatgaagcaagtatggtc
gacttagcgctaatgacgcgcatcgtacgagcgttaccagaccatgcgcgactctatttt
atcggtgatgccgatcagcttccagcagttgagcttggcaacgtgttagagcagctagtt
agtaccgaggcagcaagttttgacgaaaatgcgaatgtgccaaatggtacaaatagctta
aacagcaatgacaacgcgttttctttaggtggcgtgccatcgttaatgcgtcagcacatc
gctacgctgtgcccgcatttgcctctgttacctgttgatgagcaggcaaaaagctatgta
gcaactctgcaagcaccgcagcgcttcaaagggcaggtggcaaaagttgcaacggccata
cagcgaggtgatgcaagcggtgcacttgccgctattaccgacaaggctagtgacaatgat
gaaactgctggcctcaactcaaatatcgattcaactcttgtttcaaagactgcatcacgc
ctacaatctggcgttcacctatggccagagcaccaggttagcggccgtgatttacaccag
ttggccaaagaaagcttcctgcctatttttgatgctggcagtgccgaagaggcgcttaat
cgtctgaatgtggttaggtggctaaccccggtccgcaagggcggaatgggcgtagaaggc
ctgaataatttggtgttcgatgctatcaagcacaaaatcagaaagcgggaaggccatttc
tatcaaggtcagcccattatgattgtaaagaatcatcatcctcaacgactatcaaacggt
gaggttggtgtaatctggcctgacagcaaaggaaagctatatgcgtggttttaccaggat
agccaagcttcgggtcaaaacggttcaagtcagaaagcttcggcaaatgcgggagacagt
gctgacaagacgctagcgcaaaaacaagcgttgcgcagcatatcgctatcaagagtaccg
cagtttgaaactgtgtatgccatgaccatacataaatctcagggctctgagtttaaccaa
gttgtgcttattctacctaagcctgatagcgaaaaagccgccaatttatttcatcgaggc
ctagtatacacagggttaacccgtgctaaagacggctgcttaatcatctctgacaccgct
acatttagccacatggttcagcgggtggataagcgttattccgggatgtctgaagcgatt
agcctgcacctagagagcacatcaaacgccaccccagagattgaatag

DBGET integrated database retrieval system