KEGG   Alteromonas macleodii ATCC 27126: MASE_11590Help
Entry
MASE_11590        CDS       T02246                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MASE_11590
Enzymes [BR:amac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MASE_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2708936..2710432
Genome map
AA seq 498 aa AA seqDB search
MSIRNGVQLITYADRLGDGNIESLTSILQGPLGGLFTGVHILPFYYPYDGEDAGFDPIDH
TLVDERLGDWDNVKKLGESVDIMADLIVNHMSGQSEAFKDVLKNGRESSYWPLFLTKEDI
FKDNDQTQIDEQIAQVFRPRPTPFFSDYEVGTETGNPETVPFWTTFTSNQIDIDVESQLG
KDYLSSILQSFTESNVDLIRLDAAGYAIKRAGSNCFMLEETFEFIEELSNRARGMGMQCL
VEIHSHYQTQIDIAARCDSVYDFALPPLVLHTLFSKNAEALAYWLSISPRNCFTVLDTHD
GIGIVDVGANGDKPGLLTADAINSLVDQIHENSNGESKKATGAAANNVDLYQVNCTYYDA
LGKDDFAYLVARAIQFFSPGIPQVYYGGLLAVENDMALLAKTNVGRDINRPYLSTAMVKE
AVEKPVVKGLMQLIRLRNESDAFNGVFDVSYINNVFVLSWKNGNHAASLNVNFSTMDATI
HTVDNGEESVLSINTLLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctatacgcaatggcgttcaactaatcacctatgcagaccgactaggcgatggcaac
atcgagagtctaacaagcatacttcagggcccgttaggtggcctgtttacgggtgttcac
atccttcctttttactacccttacgatggtgaagacgcgggtttcgatcctatcgatcat
accttggtcgatgagcgcttgggcgattgggacaacgttaaaaagcttggcgaatcggta
gatatcatggccgacctcattgttaaccatatgtcggggcaaagtgaagcgttcaaagac
gtgctgaaaaacgggcgcgaatcgagttattggccgctgttcttaaccaaggaagatatt
tttaaggacaacgatcaaacgcaaattgacgaacaaatagcacaagtgttccgccctcga
cccacaccgtttttcagcgattacgaggtgggcacagagactggtaaccctgaaaccgtg
ccgttctggacaacttttacctctaatcaaattgatattgatgtggagtcacagttaggc
aaagactacctatcttctattcttcagtcgtttactgaaagtaatgttgatcttattcgc
ttagatgcggcgggctatgcaattaaacgcgcgggttcgaactgctttatgcttgaagaa
accttcgaatttatcgaagaattatcaaaccgcgcacgtggtatgggcatgcagtgtttg
gtcgaaatacacagtcactatcaaactcaaattgatattgctgcgcgttgcgacagtgtt
tacgacttcgctttacctccgcttgtactacacaccttgttctctaaaaatgcagaggca
ttggcatactggctttcaatttcgccacgtaactgctttaccgtgctagatactcacgat
ggcatcggcattgttgacgtgggcgcgaatggtgacaaaccaggcctgcttaccgcagat
gcgattaattcgctcgttgaccaaatacatgaaaattccaatggcgagtctaaaaaagcc
accggtgccgctgcaaataatgtagacctttaccaggtaaactgcacatattacgatgcg
ttaggtaaagatgacttcgcttatttggttgcacgcgccattcaattttttagcccgggt
atccctcaagtttattacggtggcttgcttgctgttgaaaacgacatggctttacttgct
aaaaccaatgttggccgcgacatcaaccgcccatacttgtctactgccatggtaaaagaa
gccgttgaaaagccagtggttaaaggcctgatgcagcttattaggctaagaaacgaaagc
gatgcttttaacggtgtatttgacgtgagttacatcaacaacgtattcgtgctttcgtgg
aaaaacggcaaccatgcggcgtcactaaacgtgaacttcagcacaatggatgcaactatt
catacggtggataatggtgaagaaagcgtgttgtcaatcaacacgctacttgcttaa

DBGET integrated database retrieval system