KEGG   Alteromonas macleodii ATCC 27126: MASE_12185Help
Entry
MASE_12185        CDS       T02246                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
amac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MASE_12185
DNA repair and recombination proteins [BR:amac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MASE_12185
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MASE_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim zf-RING_9 HHH_5
Motif
Other DBs
NCBI-ProteinID: AFS37954
Position
complement(2838274..2838873)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLSELIQALTCLPGVGNKSAQRMAFHLLERNRTGAIDLSNVLHNAMEHIHHCKRC
RTFTEDELCDICRHPEREASGLLCIVESPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGP
EEIGLTELEARLAAGGINEVILATNPTVEGEATAHYIAQLCASHNVDASRIAHGVPVGGE
LEYIDGNTLTHAFSGRRKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcagtccgctactctcagagttaattcaggcactaacgtgtcttcccggcgtt
ggcaacaagagcgctcagcgtatggcattccacctattagagcgtaatcgcactggggca
attgatttaagcaacgtattacacaatgccatggagcatattcatcattgtaagcgctgc
agaacatttactgaagacgagctatgtgacatttgtcgtcaccctgaaagagaagcaagt
ggcttgttatgtattgttgaaagcccacaagacgtactagcaatcgaacaaaccttaagt
tacaaggggcagtattttgtgcttatgggtcatttgtctcctattgacggcgttgggcca
gaagaaattggtcttactgagcttgaggctcgtcttgccgcaggtgggataaatgaagtt
atcctcgccacaaacccgactgtagagggggaggccacggcacattatatcgctcaactt
tgtgcaagccataacgttgatgcgtctcgaattgcccacggcgtgccggttgggggagag
ctcgagtatattgatggtaatactctcacccacgcattttcgggtcgccgcaaactatag

DBGET integrated database retrieval system