KEGG   Alteromonas macleodii ATCC 27126: MASE_12760Help
Entry
MASE_12760        CDS       T02246                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:amac00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:amac00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:amac00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:amac00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2969535..2970551
Genome map
AA seq 338 aa AA seqDB search
MSLLKPFVFLAAFAACTPVCAQQSQEVVSEQASSSENSEQERTIENEENQSSQDESGIEV
IDIIKRDTITESALDNRLEGDKEALDNVFAITQHRQNYLLPITYVSNPSSVASEELTNEN
IDNKEAKFQVSAKLPLYLEDTGFDGVYFGFTLTSFWQLYNSEASKPFRETNYEPEVFWQE
TADYSVLGYKFNTFQVGFNHMSNGQSGLRSRSWNRIFASIVFSDDDDIYYLKTWYRIPED
EKTDPLDPTGDDNPDIQDYYGRMELGYGRKIGAFKVLALLRNNLDVDENRGSIQLDFTYP
ISDRYEVLLQYFNGYGDSLIDYNRSQERIGIGFQLHFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgtctttgttaaagccttttgtatttttggcagcatttgctgcttgcacgcctgtttgc
gctcaacaatcacaagaagtggtaagcgaacaagcgtcatcttcagaaaatagtgaacaa
gagcgcactattgaaaatgaagaaaatcaatcgtcacaggatgaaagcggtattgaagtt
atcgatatcatcaagcgtgacaccatcacggaaagtgcactggataaccgattagaaggc
gataaagaagcactggataatgtgtttgctatcactcagcatagacaaaactatctactt
ccaattacttacgtttccaacccaagctctgtggcaagtgaagaactcacaaacgagaac
atagacaataaagaagcaaaatttcaggtaagcgcaaagctgccgctttatttggaagat
acaggattcgacggtgtttactttggctttacgctaacctctttctggcagctttataac
agcgaagcgtcgaagccgtttcgcgagaccaattacgaaccagaagtcttttggcaagaa
acagccgattattccgtgcttggctacaaatttaatacttttcaagttggtttcaatcat
atgtctaacggtcaaagcgggctgcgctctcgaagctggaaccgtatatttgcctctatt
gtctttagcgacgatgacgatatctactacctaaagacgtggtaccgtattcctgaagac
gagaaaacagacccgcttgatcctaccggcgacgataaccctgatatacaagactattac
ggtagaatggaacttggttatggaaggaaaattggcgcgtttaaagtactggcgctttta
cgaaataacctcgacgtagatgagaaccgaggcagcatccagctagacttcacctaccct
atctctgaccgctatgaagtcttgcttcaatacttcaatggctatggcgattcgcttatc
gactataaccgctcacaagaacgtattggtatcggttttcagctgcactttttgtaa

DBGET integrated database retrieval system