KEGG   Alteromonas macleodii ATCC 27126: MASE_13040Help
Entry
MASE_13040        CDS       T02246                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amac01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amac00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3030067..3031662
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGAEDLSE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcaaaaccgttttaaa
acaggtttagacattgctcgctacactgcaagcattatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggcttcgtaggccaa
caaaaaatgctttcagttaaaaagcatcaaggcacaactaacaaaagctacctttacctt
tcaggctggatggtagcagcacttcgctctgaatttggtcctcttcctgaccaatcaatg
catgaaaaaacatcagtgtctgcgcttatcgaagaactttatactttccttcgccaagca
gatgcgcgtgaattaggcgaccttttccacaagctagacgacgctaagaaaaacggtggt
gatgtagctgcgattcaagctgaaatcgacaattacgaaactcacgtagttccaattatc
gcagatatcgatgcgggctttggtaacgaagaagcaacctacctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaattgagaaccaagtatcggacgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcgaaaatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtcttactcagaagatcccagtatctacatcagaaggcgacttagct
gctcagtacaatgcgttccttaaaactaccgaagttgcaggggcagaagatctaagtgaa
ggtgacctagttcttaagcaaggtggcaaactggttaagcctgagcgtctaccaaacggc
ttgttccgctttaaagacaacacaggttttgaccgtgtagtacttgactgcgtaacgtca
cttaagcacggcgctgacttgctttggattgaaactgaaaagcctcacgttggccaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaacgcaaagctggtttataacaac
tctccatcattcaactggacgcttaacttccgtcagcaagtgtttgatgcttggacagaa
gaaggcaaagacgtatctggctacgaccgcgcgaaacttatgtctgccgactatgatgac
agcgaacttgcagcagcagcggacgagaagattaagagcttccaggctgacgcagcacgc
gaagcgggtatcttccaccaccttatcacgctaccgacttaccacactgcagcgctgtct
actgacaaccttgcaaaaggttacttcggtgaagaaggtatgcttgcttatgttcgcggt
gttcagcgtcaagaaattcgccaaggtctagcgtgcgttaagcaccaagcgatggcaggt
tctgacctaggtgatacacacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaaccagttcgacgtataa

DBGET integrated database retrieval system