KEGG   Alteromonas macleodii ATCC 27126: MASE_13040Help
Entry
MASE_13040        CDS       T02246                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MASE_13040
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MASE_13040
Enzymes [BR:amac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MASE_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3030067..3031662
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGAEDLSE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcaaaaccgttttaaa
acaggtttagacattgctcgctacactgcaagcattatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggcttcgtaggccaa
caaaaaatgctttcagttaaaaagcatcaaggcacaactaacaaaagctacctttacctt
tcaggctggatggtagcagcacttcgctctgaatttggtcctcttcctgaccaatcaatg
catgaaaaaacatcagtgtctgcgcttatcgaagaactttatactttccttcgccaagca
gatgcgcgtgaattaggcgaccttttccacaagctagacgacgctaagaaaaacggtggt
gatgtagctgcgattcaagctgaaatcgacaattacgaaactcacgtagttccaattatc
gcagatatcgatgcgggctttggtaacgaagaagcaacctacctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaattgagaaccaagtatcggacgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcgaaaatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtcttactcagaagatcccagtatctacatcagaaggcgacttagct
gctcagtacaatgcgttccttaaaactaccgaagttgcaggggcagaagatctaagtgaa
ggtgacctagttcttaagcaaggtggcaaactggttaagcctgagcgtctaccaaacggc
ttgttccgctttaaagacaacacaggttttgaccgtgtagtacttgactgcgtaacgtca
cttaagcacggcgctgacttgctttggattgaaactgaaaagcctcacgttggccaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaacgcaaagctggtttataacaac
tctccatcattcaactggacgcttaacttccgtcagcaagtgtttgatgcttggacagaa
gaaggcaaagacgtatctggctacgaccgcgcgaaacttatgtctgccgactatgatgac
agcgaacttgcagcagcagcggacgagaagattaagagcttccaggctgacgcagcacgc
gaagcgggtatcttccaccaccttatcacgctaccgacttaccacactgcagcgctgtct
actgacaaccttgcaaaaggttacttcggtgaagaaggtatgcttgcttatgttcgcggt
gttcagcgtcaagaaattcgccaaggtctagcgtgcgttaagcaccaagcgatggcaggt
tctgacctaggtgatacacacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaaccagttcgacgtataa

DBGET integrated database retrieval system