KEGG   Alteromonas macleodii ATCC 27126: MASE_13050Help
Entry
MASE_13050        CDS       T02246                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amac01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:amac00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amac00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032988..3035183
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDKDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVNGNEYTDFLKSIGYLVEQPSQVSAQTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISSEGGAEAGKSYNPVRGAKVVAKAKDYLDSMIPL
AKGSHADVTEYKIESGKLAITLADGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMTKGGKQLVRAMHDDRSYQPSKHASQDELKDGELVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
AIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMTAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDENFSGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMAPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgattacaggttgccgaacaactcgataactttatt
aatgaacaggcacttcctggcacaggcgtagataaagacaccttttggcaaggtgcagaa
accctcttcgaaaaattcattcctcaaaatcgcgcactattagaaaagcgagaacagctt
cagcgcgctatcgacgattatcataaagctggtaacccggtaaacggaaacgaatatacc
gacttcctaaaaagcatcggttaccttgttgagcagccgtcacaagtaagtgcacaaaca
caaaatgtagacgccgaaatagcaacaatggcaggccctcagctagtcgtgccaatcaac
aacgctcgctatgcacttaacgcggtaaatgcccgttggggtagcctttacgacgcacta
tacggcactgatgtcatcagcagtgaaggtggagcagaagcgggaaaaagctacaacccc
gtacgcggcgccaaagtagttgcgaaagcgaaagactatctagatagcatgatacccctt
gcgaaaggcagccacgctgacgttactgagtataagattgaatcgggtaaattggcgatc
actcttgccgacggcgatgaaaccaccttagcaaacacagagcaatggcaaggataccaa
ggtgacattagcgcaccgtcaagcctgctatttgcacacaacggtctgcattttgaaatt
caactagacccgactcaccctattggcgagagtgatgccgcaaacgtaaaagacgtactg
gttgaagccgcattaaccaccataatggactgcgaagattccgttgctgctgttgacgct
gaagataaaaccttggtgtatagcaactggttaggcttaatgaaaggctcgctaagcatt
gaaatgacaaagggcggcaagcagcttgttcgcgctatgcatgacgatagaagctaccag
ccgtctaaacacgcttcacaagacgagctaaaagatggcgaactagtactttctggtcga
agccttatgtttgttagaaacgtgggccatcttatgactaacaatgctatgctctttgac
ggcgaagaagtgccagaggggatcatggacggtttagtcacttcacttatcgcaaagcat
gatcttttaggaaacagcaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcattgtttggtgctatcgaa
gcgattatcgatgttccagctaacacccttaaaatgggcataatggatgaagagcgccgt
acgagtattaatctacaagcttgtattgccgaggctacttcacgcgttgtgttcattaac
acgggcttcttagacagaaccggtgatgaaattcatacctcaatgcttgccggccctttt
gcagaaaaagccgcgctcaagtctatggcgtggattaaggcttatgaaactgcaaacgtt
gcagtaggccttcgctgcggcctttctggcaaagcgcaaattggtaagggcatgtggcca
atacctgatgaaatgcaaaatatgatgaccgccaaaataggccaccctaaggctggcgct
aatactgcttgggttccctcacctactgcagcaacactgcacgcgcttcattaccacgat
gtaaatgtgtttgacgttcaaaagtcgctagatgaaaactttagtggccttgctgacata
cttaccattccattgttagaagatgcctctactttgacgcgtgagagtattaagcgtgaa
attgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaggttccggacatcaacaatgtaggcttgatggaagaccgcgcgacgttg
cgaatttcatcgcagcatatcgctaactggctagagcacggcattgtaagtgtagatcag
gtaaaagagtctttggcccgtatggctgtcttggtagatgagcaaaatgcgggggatcct
gagtatatccctatggcacctgatttagacagctcaattggcttcttagccgcaagcgat
ctaatcttcaaaggtaaagagcagcctagcggttacacagaacctttactgcacgcccgt
cgccgcgaaatgaaggcaaaacttgcagcgagctag

DBGET integrated database retrieval system