KEGG   Alteromonas macleodii ATCC 27126: MASE_13050Help
Entry
MASE_13050        CDS       T02246                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MASE_13050
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MASE_13050
   00630 Glyoxylate and dicarboxylate metabolism
    MASE_13050
Enzymes [BR:amac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MASE_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3032988..3035183
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDKDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVNGNEYTDFLKSIGYLVEQPSQVSAQTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISSEGGAEAGKSYNPVRGAKVVAKAKDYLDSMIPL
AKGSHADVTEYKIESGKLAITLADGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMTKGGKQLVRAMHDDRSYQPSKHASQDELKDGELVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
AIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMTAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDENFSGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMAPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgattacaggttgccgaacaactcgataactttatt
aatgaacaggcacttcctggcacaggcgtagataaagacaccttttggcaaggtgcagaa
accctcttcgaaaaattcattcctcaaaatcgcgcactattagaaaagcgagaacagctt
cagcgcgctatcgacgattatcataaagctggtaacccggtaaacggaaacgaatatacc
gacttcctaaaaagcatcggttaccttgttgagcagccgtcacaagtaagtgcacaaaca
caaaatgtagacgccgaaatagcaacaatggcaggccctcagctagtcgtgccaatcaac
aacgctcgctatgcacttaacgcggtaaatgcccgttggggtagcctttacgacgcacta
tacggcactgatgtcatcagcagtgaaggtggagcagaagcgggaaaaagctacaacccc
gtacgcggcgccaaagtagttgcgaaagcgaaagactatctagatagcatgatacccctt
gcgaaaggcagccacgctgacgttactgagtataagattgaatcgggtaaattggcgatc
actcttgccgacggcgatgaaaccaccttagcaaacacagagcaatggcaaggataccaa
ggtgacattagcgcaccgtcaagcctgctatttgcacacaacggtctgcattttgaaatt
caactagacccgactcaccctattggcgagagtgatgccgcaaacgtaaaagacgtactg
gttgaagccgcattaaccaccataatggactgcgaagattccgttgctgctgttgacgct
gaagataaaaccttggtgtatagcaactggttaggcttaatgaaaggctcgctaagcatt
gaaatgacaaagggcggcaagcagcttgttcgcgctatgcatgacgatagaagctaccag
ccgtctaaacacgcttcacaagacgagctaaaagatggcgaactagtactttctggtcga
agccttatgtttgttagaaacgtgggccatcttatgactaacaatgctatgctctttgac
ggcgaagaagtgccagaggggatcatggacggtttagtcacttcacttatcgcaaagcat
gatcttttaggaaacagcaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcattgtttggtgctatcgaa
gcgattatcgatgttccagctaacacccttaaaatgggcataatggatgaagagcgccgt
acgagtattaatctacaagcttgtattgccgaggctacttcacgcgttgtgttcattaac
acgggcttcttagacagaaccggtgatgaaattcatacctcaatgcttgccggccctttt
gcagaaaaagccgcgctcaagtctatggcgtggattaaggcttatgaaactgcaaacgtt
gcagtaggccttcgctgcggcctttctggcaaagcgcaaattggtaagggcatgtggcca
atacctgatgaaatgcaaaatatgatgaccgccaaaataggccaccctaaggctggcgct
aatactgcttgggttccctcacctactgcagcaacactgcacgcgcttcattaccacgat
gtaaatgtgtttgacgttcaaaagtcgctagatgaaaactttagtggccttgctgacata
cttaccattccattgttagaagatgcctctactttgacgcgtgagagtattaagcgtgaa
attgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaggttccggacatcaacaatgtaggcttgatggaagaccgcgcgacgttg
cgaatttcatcgcagcatatcgctaactggctagagcacggcattgtaagtgtagatcag
gtaaaagagtctttggcccgtatggctgtcttggtagatgagcaaaatgcgggggatcct
gagtatatccctatggcacctgatttagacagctcaattggcttcttagccgcaagcgat
ctaatcttcaaaggtaaagagcagcctagcggttacacagaacctttactgcacgcccgt
cgccgcgaaatgaaggcaaaacttgcagcgagctag

DBGET integrated database retrieval system