KEGG   Alteromonas macleodii ATCC 27126: MASE_13405Help
Entry
MASE_13405        CDS       T02246                                 

Definition
enoyl-CoA hydratase/carnithine racemase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MASE_13405
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MASE_13405
   00650 Butanoate metabolism
    MASE_13405
  Lipid metabolism
   00071 Fatty acid degradation
    MASE_13405
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MASE_13405
   00310 Lysine degradation
    MASE_13405
   00360 Phenylalanine metabolism
    MASE_13405
   00380 Tryptophan metabolism
    MASE_13405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MASE_13405
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MASE_13405
   00281 Geraniol degradation
    MASE_13405
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MASE_13405
   00627 Aminobenzoate degradation
    MASE_13405
   00930 Caprolactam degradation
    MASE_13405
Enzymes [BR:amac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MASE_13405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3119150..3119806
Genome map
AA seq 218 aa AA seqDB search
MAFNLAINNDIAVITFDDGKVNAVGFELIQQFNDALDEAEQNAKAVVLHGGEGKFCGGFD
LSVMKADDKAKQHELVSKGAELIVRLYSFPLPVVVAAEGHSIAMGAIMLMAADLRIGKDA
DTKYGLNETAIGMVLPPFGMELAKARLANTSQTEALLFSRIYQGSEAVKAGFLDAAVPQE
QVLATAMGYAEKLKMLPRQSFAESKIQLRKETIAKMQA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttaatttagctattaataacgatattgctgtaatcacctttgacgacggaaaa
gttaacgccgttgggtttgagcttattcagcagtttaacgatgccttagatgaagcagag
caaaacgcaaaagcggttgtattacacggtggtgaaggcaagttttgcggcgggtttgat
ttatcggtaatgaaagccgacgacaaagcaaaacaacacgagttggtgtcaaaaggcgct
gagttaatcgtacgtctttatagcttcccactacctgtagtcgttgctgcagaaggtcac
agcattgcaatgggcgcaattatgcttatggctgctgacctacgcattggtaaagacgca
gatactaagtatggtcttaatgaaaccgccattggtatggtactgccgcctttcggtatg
gaactagccaaagctagattagcaaatacgtctcaaactgaagctttacttttctcacgt
atttatcaaggcagtgaagcggtaaaagcgggctttttagatgctgcagtacctcaagag
caggtattagcgacagccatgggttatgcagaaaagttgaagatgttgcctagacagtct
tttgctgagtctaaaattcagttgcgtaaagagacaatagccaagatgcaagcctag

DBGET integrated database retrieval system