KEGG   Alteromonas macleodii ATCC 27126: MASE_13935Help
Entry
MASE_13935        CDS       T02246                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MASE_13935
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MASE_13935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3247108..3248004
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVDHFVQPGETLASTHYQTLLGGKGANQSIALAQAGADVRHVGSI
HENDASFKQALIKKGVDCRGVKCSEVPSGHAIIQVTPSGENAIVLFGGANQTITAKTVMQ
ALDDTRPSDWVLTQNETSSIEEVLRQAKEKQLKVAFNPAPMSESVKQLPLDCVDLLIVNE
TEAAAITGKEELEDIVTVFKEQWSHSEVIITLGKAGVMMLRKNDVVEVKAFSVDAVDTTA
AGDTFIGYFLSAYSNHTDAKQALRRGCAASAIAVTREGAAQSIPTQKEVDRFLAKHAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctataaatattgaccacgtttatcaggtagatcacttt
gtacaacctggtgagacgttggcctctacccattatcaaaccttattaggtggtaagggt
gcaaaccagtctattgctttagcgcaagcaggtgcagacgtaagacacgtcggcagcatt
cacgaaaacgacgcctcatttaaacaagctcttattaagaagggtgttgattgtcgtggc
gtaaagtgctcagaagttccttcaggtcacgcgattatccaagtcacgcctagcggtgaa
aacgccattgtattatttggtggtgctaaccaaaccattaccgcaaaaaccgtaatgcaa
gcgttagacgatacgcgtccttcagattgggtactaacccaaaatgaaacaagcagcatt
gaagaagtacttcgccaagcgaaagaaaagcagcttaaagtagcctttaacccagcgcct
atgagcgagtcggttaaacagcttccgttagactgtgtagatttacttattgtaaatgaa
accgaagctgctgcgatcaccggtaaagaagaacttgaagatattgtgacagtgttcaaa
gagcagtggtcacacagcgaagttattattacactgggtaaagcgggtgtaatgatgctg
cgcaaaaacgatgttgtagaagtaaaagcattctctgtagacgcggtagataccaccgca
gccggtgacacctttatcggttatttcctgtctgcatacagcaaccacaccgatgctaaa
caagcattgcgtcgcgggtgtgcagcttcagccattgcggtaacacgcgagggcgcagcg
cagagtattccaacacaaaaagaagtggatcgtttcttagcgaaacacgccaactag

DBGET integrated database retrieval system