KEGG   Alteromonas macleodii ATCC 27126: MASE_14535Help
Entry
MASE_14535        CDS       T02246                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MASE_14535
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MASE_14535
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MASE_14535
Enzymes [BR:amac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MASE_14535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3380741..3382024)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISSLQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKRDQLV
ISVPSGNFGNLTAGMIAKSLGLPIKRFIAATNLNDTVPRYLKTGEWEPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMMDLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttatttcccagagcatattcctaccctagacaat
attgacgaattgttggaaaagccatttgtagagcgcagtattgaagtacttcgcgccctt
atcggcgatgagctgaataatggcgagctagaagaaattgttcagaccgcatttgctttt
ggtgcaccagttgagcaggtcaacgataacgtatactgcttagagcttttccatggtcca
acgctggcgtttaaagattttggcggccgctttatggcgcaaaccctgtcgcgtattagc
gaagggaagccagttaccattctaacagcgacttcaggtgataccggcgcagcggttgca
catgcatttcacggcatcgacaatatcaacgtggttattttgtttccaaagggcaagatt
agctcgctgcaggaaaagctattcactacgctaggcggtaatattcataccgttgctgtt
gagtcagactttgacgcatgccaatcactagtaaaaaccgcgtttgacgaccctgacgta
cgtgaaggccttcacctgaactcagcaaactcaatcaacatcagccgtttactagcgcag
gtttgctattactttgaagcagtaagtcagttgccaaaagagaaacgagaccaactcgtt
atttcagtacctagtggtaactttggtaaccttacggctggcatgattgctaaatcgtta
ggtttacctataaagcgttttatcgcagcaactaacttaaacgacacggtacctcgatac
cttaaaaccggcgagtgggaacctaaggcgacggttgcgaccatgtctaacgcaatggat
gtgagtcagcctaataactggccgcgaatagaggcgcttattgagcgtggctatatcgac
aaagcgtgtcttaaaggtgagatggttgacgaagaatatacgcagcttgctatgcgtcaa
ttagcgcaacaaggctataccagcgagccacatgccgcgattgcctatcgcgcagtaagt
catgacttagaagacggcgaaattggtttgttcttaggaacagcgcacccggctaagttc
agagaaaccgttgaaaacgtgctaggtaatccaatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttagcggtagacttgccagcgtcttacgatgcacttaagcag
catatgatggatttgcttaagtaa

DBGET integrated database retrieval system