KEGG   Alteromonas macleodii ATCC 27126: MASE_15120Help
Entry
MASE_15120        CDS       T02246                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MASE_15120
   00240 Pyrimidine metabolism
    MASE_15120
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MASE_15120
   03430 Mismatch repair
    MASE_15120
   03440 Homologous recombination
    MASE_15120
Enzymes [BR:amac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MASE_15120
DNA replication proteins [BR:amac03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MASE_15120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3515275..3515697)
Genome map
AA seq 140 aa AA seqDB search
MPQVIFYQLTSSDNGVAGRASEVIASAFANKQKISVLCDTQAQAEEVDELLWQLPADRFV
PHNLYGEGPQSGTPVEICWRPEQVARRQMVVNVGSGMVPSPNQHRQIIDFVPVDENAKQA
ARVRYKNYQQAGCNMQFKSA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccacaagtgatattttatcaacttaccagcagtgacaatggtgtggcaggccgcgcc
agcgaagttattgcatcagcgtttgccaataagcaaaagattagcgtgctgtgcgataca
caggcgcaggctgaagaagttgatgaattgttgtggcagctgccggctgaccgctttgtg
ccccataacctttatggtgaagggccgcaatcgggaacgccggtggaaatttgttggcgg
ccagagcaggtagccagacgacaaatggtggttaatgtggggtccggtatggtgccttca
cccaaccagcatcgtcaaatcatcgattttgtacccgtggacgagaacgccaaacaggcc
gcgcgggtaagatacaaaaactatcagcaagctggatgcaacatgcagttcaaatctgca
taa

DBGET integrated database retrieval system