KEGG   Alteromonas macleodii ATCC 27126: MASE_15260Help
Entry
MASE_15260        CDS       T02246                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amac  Alteromonas macleodii ATCC 27126
Brite
Enzymes [BR:amac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MASE_15260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3551290..3552360)
Genome map
AA seq 356 aa AA seqDB search
MALIRLFATACSFLVTTAVAGDALREWYAAPIEQWPAAITADGHAPLALSPLTPIGSLAT
EQQIKLGEKLFNDPILSRDNTVSCASCHVKSLSFQDGLRSAKGVREQIGNRNTPAIFGID
HWQSFFWDGRAQTATEQALKPIENPIEMDLPLEEALKRLNTSTDYKAAFDEAYGKEHITS
AMLAMALVAFERTIPPPDSKYQRFIALAQEAPKKAQAMLSESQLEGLHLFRTKAKCMTCH
EGALLSDNDFHVTGFHRYGLSFEDLGRSEFTQNVRDIGKFRTPSLLGVSKTGPWMHNGLF
VQFRPMIEQYNAGGFRPKPNRKNAMDPHYPKTTPLIQPLNLSDDEINALVAFLNIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcactaatcaggttattcgccactgcttgcagctttctggtaacaacagcggttgct
ggcgacgcattgcgagaatggtatgccgcgcctattgaacaatggccagcagcgataacc
gctgatggccatgcgccactcgctttgtcgccgctaacgccaattggctctttggcgact
gagcaacaaataaagctaggtgaaaaactctttaacgaccctattttgtcacgagacaat
acggtgagctgtgcaagctgtcatgtaaagtcgctgtcattccaagatggcttgcgcagt
gctaaaggagtgagagagcagataggcaatcgcaataccccggctatttttggtattgac
cactggcaaagctttttttgggatggtcgggcgcaaactgctactgagcaagcgttaaag
ccaatagaaaatccaatagaaatggatttgccattggaagaagcactaaagcgcttaaat
acttcgacagactataaagcagcgtttgacgaagcctacggaaaagagcatatcacatca
gcgatgttagcgatggctctagttgcgtttgaacgtacaatcccaccgccagactcgaag
tatcaacgctttattgctttggctcaagaagcgcctaaaaaagcacaagctatgctttct
gaatctcagctagaaggattacatctttttagaacgaaagcgaaatgcatgacatgtcac
gaaggcgcactgcttagcgataatgatttccacgttacagggtttcaccgttacggcttg
tcttttgaggacttgggaagaagtgagttcactcaaaatgtacgggacattgggaagttt
agaactccatcactattaggtgtctctaaaactggcccttggatgcacaacgggctgttt
gtacaattcagacccatgattgaacaatacaatgcgggaggctttaggccaaaaccgaat
agaaagaacgcaatggatccgcactatcccaaaacgaccccgcttatacagccacttaat
ttaagcgatgatgaaataaatgcgctggtggcgtttcttaacatactttag

DBGET integrated database retrieval system