KEGG   Alteromonas macleodii ATCC 27126: MASE_15985Help
Entry
MASE_15985        CDS       T02246                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amac  Alteromonas macleodii ATCC 27126
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MASE_15985
Enzymes [BR:amac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MASE_15985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3735827..3736933)
Genome map
AA seq 368 aa AA seqDB search
MVKLHYATKATLVIGFLFLLASCSTKEDSEFKSQYIAYKALFVDGGRVVDTGNDDVSHSE
GQGYGMLFAVAANDKDTFDALWHWTQRTLMREDGLFSWRYRPCVDNSSSCIDDPNNASDG
EILIAWALLRASEKWGVGKYEEAARNIVRAVEQKLLVVNNNSVVLLPGEYGFASDQTGNS
SLQLNLSYWVFPAITDLSSLSDTPSRWESLFESGLILLSNMQFSTYQLPSDWVRFTPNSA
EPDNSKIGALTLDNVISPEFGFNAIRIPLQLAWSPRFRQNARLTEKLLSPYYAWWAITPT
PATINLLNEETAEYEMSKGMRSVQMAVNSLMKSEEKQRPEWPEINRNMDYYSASLTLLSM
LAVLDNAS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagctgcattacgcaacaaaagcgacgctagtgataggttttttgttcctgttg
gcgtcgtgctctaccaaggaagatagcgaattcaagtctcagtacatagcgtataaggca
ttgtttgttgacggcgggcgcgtggtagacacaggaaatgatgatgtgtctcacagcgaa
gggcaagggtacggtatgctctttgccgtcgccgccaacgacaaagacacctttgatgca
ttatggcactggacccaacgtactctcatgcgcgaagacgggctatttagctggcgctac
cgaccttgtgtggataattcatcttcttgtatcgatgaccctaataatgcctctgatggt
gagattcttattgcgtgggcattattgcgtgcaagtgaaaagtggggcgttggtaagtat
gaggaggccgccaggaatattgtacgtgcagtagagcagaagcttctggtggtgaataat
aacagtgtagtgctcttgccaggggaatacggatttgcatctgaccaaacaggaaatagc
agccttcagctaaatctgtcctattgggtttttcccgccataactgacctgtcttcgctg
tcggatactccgtcacgttgggaaagcctgttcgagtcgggtttgatcttgctgtcgaat
atgcagttttctacctaccaattgcccagtgattgggtgcgtttcacccctaatagtgct
gagccagataacagtaaaattggtgcgttaactttagataatgtgatatcgcctgagttt
ggttttaatgcgatccgtataccgcttcagcttgcatggtccccacgttttcgccaaaac
gctaggttaactgagaagctactttccccctactatgcatggtgggcgataacgcctacg
ccagctaccatcaacctgttaaacgaggaaaccgctgagtacgaaatgtctaagggaatg
cgttcagtgcagatggccgtaaacagcttgatgaaatcagaagaaaagcaaaggccagag
tggcctgagatcaatcgaaacatggattattactcggcaagtttaacgctgctttctatg
ctagcagttttggataacgcatcgtga

DBGET integrated database retrieval system